lynx-2.8.3.rel1/bin/lynx 755 1750 1750 4065604 6671656112 10302 P6\'>r X:t>HH@.textHH XH>T .data@@:t @.bssA>A>>.lt12069GGs".ld12076GG$LB.lb12077G$LG$L.lib@>#@Q.A /H"HJf/H#@N tN N BpNr.N +pN@Exiting via interrupt: %s %d NV/ /$.HxHxE NHxHxNHxHxNJ9@ ga,rg2J9@ .faJg$/HzHzaGLHyAjaGPOPO`aLBHxE NBHxNBHxNJ9@ Yg BHxNPOJgBav$.$nN^NuNVaD 9@ g/a 3B@ N^NuNVH 8HxHxE NHxHxNHxHxNJ9@Pg@B"9@ FS//9A6a /9A6a a/9A6a paxJ9@ g/9@ aZXOaLB@ Vl|IA:&L g /a 2DBXO 3g/a 22BXO 3g/a 2BXO 3 g/a 2 B XO 3g/a 1BXO$$R@ VmB@ VaLN^Nurel2.8.3rel.1NVHzHza .JVIDN^Nulatest releaseprepre-release versiondevelopment versionNVaJgA`HzHza AfA N^NuSun, 23 Apr 2000 18:44:03 -0700NVHx HzHyA>aAA> N^Nuw.htmlCan't open temporary file! Information about the current document%s http://lynx.browser.org/http://lynx.isc.org/current/Lynx

%s %s (%s) (%s)

Directory that you are currently viewing
%s

Name:   %4s  %s
URL:lstat(%s) failed, errno=%d
Failed to obtain status of current link!Directory that you have currently selectedFile that you have currently selectedSymbolic link that you have currently selectedItem that you have currently selectedFull name:       %s  %s
Unable to follow link%.1024sPoints to file:  %s  %s
Name of owner:   %s  %s
Group name:      %s  %s
File size:       %s  %ld (bytes)
Creation date:   %s  %sLast modified:Last accessed:Access Permissions   %s
Owner:      %s  , read, write, search, execute, setuid%s
      Group:  , setgid      World:  , sticky
File that you are currently viewing

%s

(HEAD) - HEADLinkname:
%s %s%s
     URL: %s Charset:
 %s %s
 %s %s (assumed) Server:
  %s %s Date:
    %s %s Last Mod:
%s %s  Expires:Cache-Control:bytesContent-Length:
%s %d %s Language:Post Data:
%s %s Post Content Type:NoneOwner(s):linessize:
    %s %d %s , via internal link, safesourcenormalforms modemode:
    %s %s%s%s, bookmark file, ISMAP script, no-cache%s%s%s
Link that you currently have selected(email)GETPOSTMethod:
  %s %s application/x-www-form-urlencodedEnctype:
 %s %s
  Action: %s (Form field)
 %s No Links on the current page

%s

NVlH<<*n(nBlBpz@ *WDJ9@ gHzHzHy@a4&POXO`&Hy@a8HzHzHy@a1^&POPOJfHzal~p` pHy@"nXI/ a?bPOJ@ Ro mC 瀐EB: 2 gt/a @XOJgdzeZHx/ mC 瀐/2 aGX$ mC 瀐/2 aG&S mC" 灒$r BPOXOfB0Hz/EG NHx/aϮHzHz+/NaV/a"<>Jg"<%/a/HzHzUHzV/N4./NPOJ9@ gTJ@ RoJHzV/NHzUHzz/NHxB/-GTN$.Hz^Hz`/NPOPOJg /a 'XO/-HzWHz>/NHxB mC 瀐AB:/0 N$Hn/aG.$zf2JA g/9G ,/Hza/NPOPOHzajXO`n0.@ @@fHz` @fHz<` @fHzV`HzHz/NPO.HzHz/aG0.@POPO @fRHxEt/ /aGPOXOzg AB(t`HzpHz/ aGPOXOHntHzvHz/aG$POPOB0./a z"XOJg/HzoHzz/aGPOPOB0./a {jXOJg/HzhHzp/aGPOPO0.@ @f/.HzeHzl/aGPOPOHnG bN/HzoHzz/EG NHnN/HzwHz`/N(HnN/HznHz/NHzqHz/N.Hz|/NB.vB.wB.xPOXO.gHzpHnvaGPOJ.lHzaHnvaGPO0.g@@ @@fHzEHnvaG`$Hz>Ev/ GG!NPO.g Hz,/ NPOGvHnxHz#/EG NHz/NB.vB.wB.x.gHz/ aGJPO.gHz/ aG4PO0.g:@ @@fHz/ aG` Hz/ EG!NPO.g Hz/ NPOGvHnxHz/EG NHz/NB.vB.wB.x.gHz,/ aGPO.gHz/ aGPO0.g:@ @@fHz/ aGt` Hz/ EG!NPO.g Hz6/ NPOHnxHz/aGhPOXOJg /a #"XOHz`HzHz3/aG>/Ep/ a Hx/ aŬJ-g.Hz/.pE NPOJfHz/.pNPOJf <` <//.pHzHz/GG N/-El/ a hHx/ a: .lHz/NENPOXOJgN/HzHz/N`Hx/9@ $a J$HPOJg" jJgJgHx/9@ $a POJlB/9@ $a $HPOJg8 jJg0Jg,B/9@ $a POJm/*HzqHz/aG POPOahJgJg/HzHz/aG POPOa$JgJg/HzHz/aG POPOaJgJg/HzHz/aG POPOJg y@ $Jg (g/HzHz~/aG `POPO y@ $Jgl (bg/HzHzX/aG :POPO y@ $JgF (oHzj/HzjHzv/aG  y@ $Jg (lg/HzkHz/aG POPO -g(/HzYHz`/EG N/- HzmHz/N Jg / El/ a PHx/ a"POPO`HzLHnla 0PO/.lHz=Hz/EG NHz5/. Hz3Hz5/N$ <J-g < / <J-g < / 9@ 0ga6"< Jg"< `"< /Hz:Hz/N, 9@ 0f mC 瀐Ѐzf t*"(4g`$h8zg < zf < ` < /HzHz/aG POPO < JgJg /HzHz/aG POPO mC 瀐GB: s * (0g./El/ a Hx/ a/.lHz/aG H mC 瀐 s *J4gJ0fhHzHz`R mC 瀐AB: 0 g /Ep/ a Hx/ apPOPO`HzHnpa ~PO/.pHz/aGPOXOHzG/aGPO`Hz>HzW/NPOXO/a6d/9A6a <*.&n (.Bt&<BB/a6XOJfHzhabB`Hx#/EG!N(HPOJgBHx:/NHhHna /.K$NHzM/.EG N fL .g/a BXOHxHz/aWj-H/NHz /.N fHza_F`D/aGLXOJlB.J@ RgC 瀐AB:ذ Jo/HzHnaGPOXOa,Jg\J.gV&<H/9@ /R/E/ a Hn/R// G 9VN./R// N/// a ``>/9@ /R/E/ a /./R// a D.// a  POXOJA g8/.Hzar/aGPOXOJA gJ@ f/9CC:a XOa/.a5a6|XOJg# .g/a BXO .g /a B L<|N^NuNVBN^NuNV 9@r#@JlpN^NuNV 9@N^NuNVpCN^NuNVH0 $."n IA" n A Jl BɑA"lBJlDJfJo ЀS`B`vmv Ѓ$@E L N^NuNVH?<*n $9@ J]z 9@ FSf6r#@rn:lzrf*<`*<`Jf.r#@ro *<`*<lz`6|B@ RlXIB:.4Brf t* (gr g rgr fvJg t*((`/4aG^(XOJg//4/4/ /.a$o: 4 g*/aG(/"4R//4/ /.aVl$JoJgSJf yA66P2hrl>Jg: t*r f.rff n l*<'#@`6*<'`&rff n lJgr#A?`r#@`o&B#@.R@ RmJ@m Jf rfHx&`Jm HxRa* L n"n (.&..*BBJlBJl$B` o Jg g RoRJfB E L|N^NuNV/ n"n .BJlJf`&Jf`Jg g RoRHJf $.N^NuNVH> $n..BJf J8gB`BJg2(W cRJgL gr[g f0rg*r~g$CA\ QE"SHJl / aG`RA`Jf* @Jf fr[g grf.< $0@g ` R n `BLN^NuNVBa N^NuNV/ / nJgBB$Hlr@Uf _ >c RJ`AAU0(g /a XORJJf$.$nN^NuNV/ / nJgBB$Hlr@Uf _ >c RJ`AAU0(g /a XORJJf$.$nN^NuNV/ /"nJg,BJg"BEAU I2(fRRHJfB1$.$nN^NuNV nBCAU1gBRH1f N^NuNV ng&CAU1fBRHg 1g N^NuNV nBCAU1gBRH1f N^NuNV ng&CAU1fBRHg 1g N^NuNV/ $n/ a&f$nN^NuNV/ $n/ aGJgBAAU20g SB2Jf$nN^Nulynxexec:lynxprog: NV/ /$./aHx Hz/E +NPOPOJgHx Hz/NPOXOJfHz/aVxHx/ap`B$.$nN^NuNVH00&n&. $n$. yA62P'I0h&| |B+B$'J'BB /aG'@B(BXOl&rl| +lV'@ r l'A / /E,/ a/ aG'@ L N^NuNVH80&n$n BJnB`VJ@f S`HAo4(3(,I/a lXOJfr@Uf _ >cRRnεg ` UL N^NuMaximum length reached! Delete text or move off field.NVH8<$n$. .JoHj,aG(@%L XO .Sxe~0; N`ttttP h\t@Vtttt&@J@f 9@UA@b n"* *mְ o j(lRH%H(" md,-Sl`Tr@҂ 9@UA@b m$"* *m> o8 j(lRH%H(" m,-SlB4- *,R`vJgl@dHzpa`V/*`6J@g2(,I/a zXOJg*2(,IAAUCf%B// a$POJfJ@gD2(,I/a 4XOJf0Jg2(,I/a XOJf%B// aZ$PO`Jg2(,I/a XOJg2(,IAAUCg%B// a$PO`J@g6 *2,I/a XOJf *2,I/a XOJf>T`GAU *2,I/a bXOJg j0,ICgRH%H`J@g *2,I/a (XOJg"j1,IAAUCfJgRI%I`B*,B(B`%L`$*BHxB/ aPOPOlBHxB/ aPOPOm`h$*BHxB/ aPOPOSxgDBHxB/ azPOPOQBBSd`$$*SxgBHxB/ aLPOPOQBBSd`$*BHx B/ a(*j$ POPOSxgBHxB/ aPOPOQBBSd` *oJ@g2,I/a XOJfRRt&jJgtJgnJ@g/ / a%@$ PO`SK%K"*o Ђ,,RnB2,`* jo K%MJ@g2,I/a XO` `|Hj,aG4%@ BL<N^Nu }{ NVH?<$nBBB.B.B.J*g@Jg8B*Hj,aG*%E "* j ЈXOmZ&* $*nLJ@g: $ԃo82,I/a XOJfR jC%I"Rn` Ѓ%@$* *Ђ"*oRJ@g<$BJo> *2,I/a 4XOJfR jC%IRHn` %@lBp,ЪIJ@gI/a XOJf|&E *l&@//*/9A6a POXOJ*g$BoHx*/9A6a yPORn`BoK@[4(@ g2 g, f8J9@f0J@f0 9@U~gJ5lHx /9A6a yd`XJ@g@.I/a XOJf,Ao Rt(x`BHn/9A6a zB.`Hn/9A6a zBPORnL$*S~g B*//9A6a xPOQBBSdJ*g *ЋoZJg* RHh/*/9A6a HzR/9A6a zZ`( RHh/*/9A6a Hx}/9A6a xhJg>//*/9A6a hPOXOJgHz/9A6a y`Hx{/9A6a x"PO Ъ//*/9A6a POXOJ@ga/9A6a ~LfJ9CC@fJ9@(xgtJg ~e// / a`B~g fBx~f y@(|g``*0@g gN` A@(~ p g4/a^b"XO f(A`x U~e0; NF                 2<n@`n `Hk,a$HXOJgBHx B/ aPOPOJgBI/a]XO@/I/HnaPOPOJf`\~ gBJ@f 9@UA@b n$B/a]dXO@//HnalPOPO`// / a:POXOJ f/ a `tBp`n fB/a]XO@/// "FNPOPOJf(JgJ@g ~}eB`<`JfBHxB/ "FNPOPO`L $<A? g /a HBXOXJl$.$nN^NuNVH<0&./aGD(tcԹ@"L<Q"z$@C E $BXOAA> JgP&H//3/aGPOXOJf s`4tcԊ"L<Q"z$@C E $BJf L B /.Hr a :$9@R"L<Q"v @C A 倔#@PO 2,g/a  9@B L N^NuNVH 0$n&n Jf `R J`PJgJRJW cJg8f,CAJgW c fRIRH`RIJgJfRJJfʑ L N^NuNVH?<(n*n..BJgJ g`JgRLW cJgJf2J@g*I/a PXOJf"n f,gW b"n I/I/a:POJf,B*RE&n RKSfJg*Jg`JfVJ@gNI/a XOJf<"n f2g.W c$.fRJRKJgtJf`(JJg`W cvJfBJ@g:I/a rXOJf*f*+fW cRJRKJgR`I/I/aNPOJfJg  gRRJRK`RJJfJg*Jgւ"n" L`bJf\`PJg  g@W c4Jf.J@g&I/a XOJf,gW cRLJgRRRLJf. L?@ABCDEFGHJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~STVWY[`cihoru     QRSTUVWX Y Z [ \^_0123456789:;<=>? @!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O`abcdefghijklmnopqrstuvwxyz{|}~1a2b3c4d5e6f7g8h9i:j;k<l=m>n?o@pAqBrCsDtEuFvGwHxIyJzK{L|M}N~OPQRSTUV      !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~     ( )!*"+#,$-%.&/'8091:2;3<4=5>6?7H@IAJBKCLDMEYQ[S]U_Wh`iajbkcldmenfogpqrstuvwz{xy|}!`!p!a!q!b!r!c!s!d!t!e!u!f!v!g!w!h!x!i!y!j!z!k!{!l!|!m!}!n!~!o!$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$$!A"B#C$D%E&F'G(H)I*J+K,L-M.N/O0P1Q2R3S4T5U6V7W8X9Y:ZNVH8 (.n `>B02(`82|EB "Ҁ$62( j ARHJo"AJgƳb LN^NuNVH0 $.&. fB`JfB`Jf BD` bT bFBAAU0g/a XO$`BAAU0g/a ` c cJ9@UgBBAAU0g/a xXO$`BAAU0gB/a R`8/9@UI/EC`N&POlB`"/9@UI/N/EN$/N `pL N^NuNVH8(n&n BJg-T nJgBE/ Hx/ aG҂POXOJg*J.g/ Hna ެ-HPOHx / aGLPOJg+ g .g"/`g nJgJf /a BJg( n LN^NuWarning! Control codes in mail address replaced by ?NV/ /$nB/ a00XOJg(CAU J b I1Wf?tRHJfJg Hza*N$.$nN^NuMalformed mailto form submission! Cancelled!subject=to=,cc=keywords=, mailto:Subject: Mailto form submission Cancelled!!!%.79sCc: %s %swMailto form submission failed!Mime-Version: 1.0 Content-Type: %s To: %s From: %s Cc: %s Subject: %s Keywords: %s Sending form content...%s NVPH><$.*. (.,.B\BTBPBXJgJgB.`B.Hx /IG!N&HPOJgB/Hn\E ,pNHx?/.\N&HPOPOJg/ HnXNB&nXRKPOJg+ ?g &fHxHzZ/ a ښPOXOJgRKJfJg@PKHx&/ aGj(HPOJgBJgE`/ aHxF/ / a:POPOJg&&nXRKJgBEAU+ ?g &fHxHz/ a POXOJfvVKHx&/ aG(HPOJgB ,g 2(gRK ,g2fJg& n\JgHz}Hn\a PO/ Hn\a POJg&&LRKJfZ&nXRKJgB&<AUKT+ ?g &fHxHz!/ a RPOXOJfVKHx&/ aG*(HPOJgB ,g "B18gRK ,g"@18fJg.JTf/ HnTa ٨PO`Hz/ E ,N/ / NPOPOJg&&LRKJfL&nXRKJgB&<AUKP+ ?g &fHx HzW/ a ؄POXOJfPKRKHx&/ aGZ(HPOJgB ,g "B18gRK ,g"@18fJg.JPf/ HnPa PO`/ / E ,NHz/ NPOPOJg&&LRKJfJ nPJgJg/a` /a BPXO .Xg/a BXXO&n\EG!Hx@/ N(HPOJgRLHx;/ NPOJg,(H&L`/.\EG!N n\XO 0,f/N n\B0XO n\JfHJg/a $B\XO .Tg/a BTXO .Pg/a BPXOHza$` .Tgt&@EG!Hx@/ N(HPOJgRLHx;/ NPOJg,(H&L`/.TEG!N nTXO 0,f/N nTB0XO nTJfJg/a tBTXO/.\ENXO .Tg/NXOJ.`f\Jg"EJg HxF/Hn``<z2`z-az(bz#czdzezfzgHx?/.\HngaPOXO@dHzG NBHxGBHn`E5NJlHza%V`J9@ f 9@ f <O/HzI/ aGˎB.@dHzNBHxPB/ N JlHzpa$`2/ a#XOJTf/ HnTa PO`HzGT/ E ,N/ / NPOPO/9@ /9@ HzLHyA?a fHzB/9A?a <$fHz,a"`Jg""FJgHz3/EG N/Hz6/N/.\Hz8/EG NPOXO y@ JgJg/Hz/NPOXO nTJgJg/Hz/aGɠPOXOHn`Hz/EG NPOXO nPJgJg/Hz/NPOXO@dHzaXOK`Hx /aG&&HPOJgjB/aG$XOrNl<$DHxN/ / aGB./ Hz/aG NN/ aGrNmHtHHz/aG( RPOXO`/aGɼXOrNl@G`$DHxN/ / aGɲB./ HzH/aGȞNN/ aG~rNmJgHtHHz/aGpPOXO/a reply_by_mail("%s", "%s", "%s", "%s") No email address is present in mailto URL!.txtUnable to open temporary file for mailto URL!body=%.78s To: us-asciix-Content-Type: text/plain; charset=%s Content-Transfer-Encoding: 8bit X-URL: X-Mailer: Lynx, Version %s In-Reply-To: <> You are sending a message with body to: You are sending a comment to: , With copies to: With copy to: Use Ctrl-G to cancel if you do not want to send a message Please enter your name, or leave it blank to remain anonymous Use Control-U to erase the default. Personal Name: Comment request cancelled!!!X-Personal_name: Please enter a mail address or some other means to contact you, if you desire a response. From: %.*s Please enter a subject line. %.70s%.63s%.70s Enter a mail address for a CC of your message. (Leave blank if you don't want a copy.) Keywords: **header== %sDo you wish to include the preparsed source?Do you wish to include the original message?pico -t%s%s %sSpawning your selected editor to edit mail messageError spawning editor, check your editor definition in the options menu Please review the message body: Press RETURN to continue: Cancelled!!! Please enter your message below. When you are done, press enter and put a single period (.) on a line and press enter again. .Send this message?Send this comment?Append '%s'?a+Sending your message...NVH?<$n,. ..BBBBBBBBBJA gH .f <^R/ f <^R/ f <^R/ f <^R/HzaH/aGXB9CC>JgJg/ Hna XO.OHz Hna٤(POXOfHza`hB.Hx?/.aG(HPOJg/ Hna njB(nRLPOJgv, ?g &fHxHz`/ a ƠPOXOJgRLJfJgDPLHx&/ aGp$POgBJg HxF/ E/ aGvB./ aPOPOJg"B&(nRLJgBEAU, ?g &fHxHz/ a POXOJfvVLHx&/ aG$POgB ,g 28gRL ,g2fJg& nJgHzHna PO/ Hna POJg"B&(BRLJfZ(nRLJgBKAUG, ?g &fHxHz#/ a TPOXOJf~VLHx&/ aG.$POgB ,g 58gRL ,g5fJg.Jf/ Hna ŲPO`Hz/ E ,N/ / NPOPOJg"B&(BRLJfR(nRLJgBKAUG, ?g &fHx Hz_/ a ČPOXOJfPLRLHx&/ aGb$POgB ,g 58gRL ,g5fJgPOHzE/ G ,NPOJg"FJg // NPO`HzG/ E ,N/./ NPOPOHzE/ G ,NHzHz4/ a ʖJg$"nJgHz2/ N/./ NHz1/ N/9A6a C$BHx/9A6a HHx/9A6a MJgHz`Hz/9A6a BPO(nE Hx,/ aG$POg:B  fRL  gJg/ /9A6NHz/9A6NPOPO"BR,(B`Jg/ /9A6a APO(nJgHx,/ aGﴈPOJgHz`Hz/9A6a ApPOE Hx,/ aGX$POg:B  fRL  gJg/ /9A6NHzP/9A6NPOPO"BR,(B`Jg/ /9A6a A POHzM/9A6E NHzx/9A6NPOPOJ@ fB.`$Hz/9A6NHx/9@ HnaHz/9A6K NBHxBI/ &<5"CNJmJ9CC>fHz/9A6N/ $<yN"BN/ Hy@ a B9CC>J.g$HzVG/ E ,N/ / NHzi/ NHzD/9A6NHze/9A6NPOPOJ@ gHz/9A6NPOHzq/9A6NPO 9@ f <O/HxHzV/ aGﲦBHxB/ "CN JmJ9CC>fHz/9A6N/ "BNHzG/ E ,N/ / NHz/ N .aA/9A6NHz/9A6NHz2/9A6NJ.fJg"FJf .` <O/J.gA`AJg"FJg F/HzI/ $gHz/9A6a >`Hz/9A6K N/ a >/ HzVHn"BNHztG/ E ,N./ NHz/ NB.POPOJ9@ fHz/9A6NPOJ@ gHz/9A6NPOHz(/9A6NHzC/9A6NPOPO 9@ f <O/HxHz/ "BNBHxB/ "CN JmJ9CC>g4Hz/9A6NHza H/aB/9A6a IB`Hz/9A6NPOE/ a2XOJ.gX(J`RL ,gAAU0fJg2Jf/ Hna PO`HzG/ E ,N/ / NPOPO nJg*Jg&Hz?G/ E ,N/./ NHzI/ N nJg*Jg&HzG/ E ,N/./ NHz/ NHz Hna POJA g/.Hza}/aG﮺POXOJ9@ Zf y@ JgtJgn&<O .g.$Hx /aG^(HPOJg~B/Hz/aGh$ POXO`HzXa/aG2POJgNBJ9@ gaPJg< <bJg <a/a8XO fJgB`Hx/aPO/aB/9A6a GZPOXOJ9CC>frgrgHz;/9@ a 7POJg&<bFBHn//9@ HzHna ú@dHz aa=4/.aݼJgaf rgrf4Hz/9A6a :Lan/a^B/9A6a E`*y@ FUMB/Hz/aG.//9A6NHzG/9A6N$ SM`2JmHz//9A6a 9POSf/9A6a M/aB/9A6a EDPOPO`,Hz/9A6E NHz%/9A6NHzV/9A6NHzm/9A6N.A6a M2B.BHxBE/ aJmvJ9CC>fnHz,/ aG0POJg\$ Hz/aGPOJgpJ9CC>fhHzM/9A6a 8/a/Hzڰ/aGB.BHxB/a4(JlHzaF/aB/9A6a D@POPO`Hz/aG襁/aΰB/9A6a DHxHxa 0"y@ FSI#@ ~PO <cJg <c/ENr#@ ~XO g/9A6a 8XO`Jf 9@ gHzf/aG$POg"y@ FSI#@ ~J9CC>g@d/9@ Hza|BPO`:B/9@ HzHna /.NIPOPO .g/a |BXOr#@ ~rfJHzHnaG~(POg6B/HzaGtXO.Hna֞POJg//.`/aG XO/aGXO/9A6a 7@dHzBa}pHxHxa //9@ /9@ HzHna 2 JA g/.Hzؒaw/aGPOXOHz/.a $POf Hza&XO .g/a zBXOJg|HzHnaG暴(POfHzma/a ``R//.aGlPOE/HxHx/ aG`POPOJg//Hx/ aG`POPO`/a /aGPOHyHxa .B9CC>PO .g/a BXOHnǎXO .g/a BXO .g/a BXO .g/a BXO .g /a rBLHzHxa -~N^NuNV n ~f N^Nu Alert!: %s Alert!: %sNV/ /$.JA g./HzEN/aG"POXOJA g N/aGXO@d/Hza/Hzata$.$nN^Nu%s %s! NV/ / .$. J9@ .fJ9@Pg /a^`JgF//Hz <AxJA g <Aj/aG|HyAjaGL/Hzaa<`j f <y/Hz <AxJA g <Aj/EG NHyAjaG/HzaaHz= <AxJA g <Aj/N JA g,/Hz~EN/aGPOXOJA g N/aG菱$.$nN^NuInfo message: %s NV/ $n@d/ ayXOJg8Jg4JA g/ HzatN/aG^POXO/ a/9CCBa ,$nN^NuUser message: %s NV/ $n@d/ ayVXOJg0Jg,JA g/ Hzas/aGPOXO/ aa$nN^NuUser message: NVH 8(n$. @d// a2POJg\JgXJA gBHzGN/EG NPOJA g"// N/NPOXOJA g HzN/NPO// aatLN^Nu%s NV/$./axd/aPOJA g/Hzar/aG$.N^NubytesKBRead %ld of %ld %s of dataRead %ld %s of data, %ld %s/sec.. (Press 'z' to abort)NVH?(.*. BaG金 @XOJf#A?#A?BA?`Jo"yA?gJ@ n .L@x#@ ,9A?$"9@ &L<<fffg~m A?gF܀#A?A?g#A?#A? .L@x#@ #|@ tJ9@ "g& 9@ on#|@ $LBHJo(LBXJo /9@ //HzHy@ a `/9@ /HzHy@ a POPO"9@ o:J9@ "g L@ m$/9@  LB/HzvHy@ a POPO`HznHy@ a POJl~oHzTHy@ a PO/9@ av&XOJA g/9@ Hzap/aGLN^NuNVJ9@ fB`B9@ pN^NuyesnoConfirm: %s (%c/%c) Confirm: %s (%c) - NO, not interactive. %s (%c/%c) %s (%c) Confirm: %s, cancelledYESNO- %s%s. NVH?<&.InGnxBAAU0(g/a XO$`BBAAU0g/a XOg` fIGB9@ J9@ .gr f.JA grI/I//Hzao\/aGl`2JA gDr f`I//Hzao(/aG8POPOJA gHzao /aGB`&B|y<n:A.gfB.2 gfB:Ar f"I/I//HzzHna `.r f ` (. `xI//HzVHna POPOJ@ g"JA g/.Hz9anX/aGhPOXO@d/.asXO .g/a BXOJlBEAU.I< IHxa&XOrgrf@ B`2Xg/a XO$`BB2g /a XOg^B2g/a XO$`BB2g /a XOgJ.g$B2g/a XOg`fx`22 JgB2g /a \XOgBr fJmJA g: <yJ9@ g </ <Jg </Hzal/aG LJg 9@ 4` 9@ ,// a POE@ ,JgE@ 4 g /a BXOJg//`/Hza&POJfJ@ 0f fHJ@ 8g@Jg 9@ 8` 9@ 0// a *POJgE@ 8`E@ 0 g./a *B`" SJgJg Hza(` Hzr/ a L N^Nu%s cookie: %.*s=%.*s Allow? (Y/N/Always/neVer)'A'lways allowing from domain '%s'.Rejecting this cookie.ne'V'er allowing from domain '%s'.Allowing this cookie.NVH?<(n*n ,..<Jgt ,gzgdJ9@ .g 9@ I`pJ9@ fB/GG!NzЅ$9@ J/ N$BPOJl/N&/.N("҄POlBC E LA$L(&L<<Qz&L$L<,Q(/.//// /Hna @d/.ai .g/a HBXOJ9@ gpA`0HxaJXOBAAU0g /a zXO`zAg$m zg,z` zVg.mzNg`zYg0`B/Hz aB`&Hz$aB`z)E/Hz'a$`Hz@a@pL<*.&n xBBBBA|dJ9@ .gB-f\ </`RJ@ *ftB"y@ FUI/ /9A6E N/ HzHnK 6N/./9A6&< "CN.A6I NB,9@ FS//9A6N/"9@ JpF n ]/HzUHnN./9A6"CN/9A6NPOXO-f@dHz'` @dHz8afXO`H <-f <l/Hx/ HzHna HzE/ a // a $JlBJg|g`"@d/.` @d/.afhXOHxaXOAAU08g /a 2XO`|Gg`m|g.|Cg(`t|Pg|Ug2`f .g/a BXOx`` .g/a tBXOB`HJ@ *g:|g.t`0-f .g/a BBXO(</`|fB`tJm .g/a BXO .g /a B L<|N^NuNVJ9@ fJ9@ fJ9@Pg /9CCFa LN^NuNVJ9@ fJ9@ fJ9@Pg /9CCBa  N^NuNVJ9@ fJ9@ fJ9@Pg /9CC:a N^NuLynx2.8.3rel.1[X][ ](*)( )(Unstyled)NVJ@ 0oaB y@ Jgpmp!@N^NuNV .". b Jg "<JfpL/a ^ XOg /a p`BN^Nu with POST dataunknown anchor *** Emergency freeing document %d/%d for '%s'%s! Memory exhausted, display interrupted!Memory exhausted, will interrupt transfer!NVH88&.$. (LH/HxaPOJfZ/9@ a p(@GXOJo/ /9@ a $HPO@ fJA gT <HJg RJg J g </"<Jg RJg (g"// HkHza]/aG/ /9@ a / a(LH/Hxa6JfSKJnTHxah"XO y@ Jgxmr(LH/HxENPOJf aHxBNPOJgHHzsaXO`: y@ JgJf*HxBNPOJgHznaXO y@ Jgx!D//a LN^NuNV/ / $nHx/G !N%@POl&HxHx/9@U/a Hx/N%@Hx/a L%H$n&nN^NuNV/ $nJg0 *g/a BXO *g/a BXO/ a $nN^NuNV/ /$.$BBJg $jJg Jg/aXO`/a >$.$nN^NuGridText: start HText_new GridText: Auto-uncaching GridText: Freeing off cached doc. HText_New./GridText.cwww/sourceNVH 8(nHxHxa 4&HPOJf`JA gHzTa[/aG PO 9@ g./aXOJg a|.Jgt y@ hQR y@ B(QJ@ f a #@ ,g@//9@ a POJA gHzaZ/aGPO lB/,aBXO/ /9@ a $/9@ a POXO@ o0JA gHzaZ>/aGNPO/9@ a H/aFPOHxHxa 'H$HPOJfHzHzaPO%J$B BB BBB'|@ f6B>&B |OB+%B&J(f.BHx/,EG|NPOXOJfBHx /,NPOXOJgB.`'y@ .B*BJ,ffJ g<@2B+3B+4Hza s\XO@f|$`B+$/ / a ~B@ 0#@ #@ $B:B`Bdt'BhBlBpBtBxB|B+/ a>"9@U @[///+/+HkaЈ./ a //,0/ a AA? .g:HxHx./EG!PNB9ACB9ACHxHx_HyCCJNB9CGIB9CGJB9@ \B9@ ]J9@ g@4B@6t'BX'BT K LN^NuNV/ / $n /.a&HJg'J"RA K $n&nN^NuNVH<*nJg B/a PO$mJg4 R!j j +jgJg/ a t`/ a hXOfBJg&m+Sr$f k(Jgrfn (,gh(@$L(l g /a BXO *g/a BXOJg / a XOJf k(B, k(B k(B k(BB k(BF`p k( ( g/a k(B XO k( (g/a k(BXO k( (Bg/a x k(BBXO k( (Fg/a \ k(BFXO k( g/a B k(BXO k( (0g/a ( k(B0XO k( (8g/a k(B8XO k( ( n + B?n //Hz`H"kA"9CGNlFJoB Ё&LA8 S /$+>o Ё(LAH"`"/HzHnaGPOPO`B.J@g nJgHx/aGXO/a ~$HPOJgz 9@Uxf/ /.a PO`Bxf/ /.a PO`,B nJg1 gRRI nJ1fB2/ Hna POJg / a XOBB/9A6a 6/9A6a POPOJ>o / a^XOJgHx#/9A6a POG/ EG!NR$9@ J/.N"BPOJo/ `&/ NT(9@ J "@SIXOJm nB1HxB/9A6a PO./9A6E NPOJ.gHn/9A6NPOHx /9A6a JPO .g/a BXOa2L N^Nu Error accessing document! No data available! line->next != NULL Error drawing page! Bad HText structure! line != NULL GridText: Not showing link, hightext=%s Maximum links per page exceeded! Use half-page or two-line scrolling. display_page: MAXLINKS reached. Document is emptyNVH?<(.&. ..2|-I@ 0Jf#KB/aj<XOJ9@4g$"D )\g/av, йCGNXOl ,`,ܹCGNJgNJ9@4f"DTg"DB)QʵCGNl,J9@ fJfvHxaHznHzIa POXO`^JfZJ9@ g,Hx*/9A6a /9A6a `/9A6a XPOPOHz/9A6a p/9A6a 4B@ R`rJ9@4f*"DTf"A8XnBHj/9A6a POXO`/Hj// ahPOPO"Df:RJCGNlRB$ R//9A6a D/9A6a POPO$BCGNm`"J9@4gC8-I<&SRJCGNm"D#KFB)OB@ R(iJgKB: ,mn\oVJ,,gj ,gb/aGzrXOJgR,'gH y@ RC 瀐Ѐ++ + - y@ RC 瀐Ѐ+"+&/,0a wv XOJ9@ g /aD`/a qp$XO y@ RC 瀐 5 g/a y@ RC 瀐B XOJg y@ RC 瀐+ `"/9@ y@ RC 瀐Hu a 8PO y@ RC 瀐Ѐ+  CSH",+Bgr`r+ y@ RC 瀐Ѐ+@ B*RH#@ R<`r$f l(rg@ 0$l( y@ RC 瀐Ѐ+"+&+*+  CSH",+r+- y@ RC 瀐Ѐ+@ /9@ Hua D *POrf>J g y@ RC 瀐+@ T ` y@ RC 瀐+@ X `rfnJ9@ fJ9@ (f #@T#nX` r"D#AX#AT"D )PgiQRHx/9CGRa PO/9A6a Lsize==%d ! split adjusted to %d. GridText: split_line(%d [now:%d]) called split_line_2anchor %d case %d: split_line anchor %d line %d: This should not happen! anchor %d: (T,H,S)=(%d,%d,%d); (line,start,pos,ext):(%d,%d,%d,%d)! (T,H,S)=(%d,%d,%d); (line,start,pos,ext):(%d,%d,%d,%d))->(%d,%d,%d,%d) NVH?<,. "n*i6J)Ng-m `-m$"n-iBBB&iB-y@ bHxHxa$HPOJfHzHzaPOB@ ^B@ b"n| 3A g fz+ gZn gR`f f`A`V@ \`@ \`jB9@ \``@ ]`@ ]`B9@ ]` (fhP + drJA g//HzcaA/aGr.POPO cH,+ Hx HkaGsPOJg xl,JA g/HzQa@/aGqPOXO"nR S!J%K$&#JB BBJB*Jf`J9@ .gJ9@ 4f&J9@ \g J |R * B2R@ ^Jf&J9@ ]g J |R * B2R@ ^=m,Jg8Azڊ + B0'F Ih9@ \9@ ] f2Jf2"nJf(Jf$Jf nfJm:fJJA gHx/+Hz a9(/aGj8POPO$B ꐮЮ-@`JA gHx/+Hza8/aGiPOPO$B"E-I`l8JA gHx/+Hza8/aGiPOPO$n -C`hJA g/+/+HzmIN/EG NPOPOJA g/+/+ /+/+/./././+Hz`N/N(`JA g2/+/+ /+/+/././.Hzna7/aGi$ gފ'Gl S$@"n'i'J 'nJA g&/./+ /+/+HzJa7/aGh(K&SJfzL<&n.Jg0 +|l"|fBBxHz/ a$|'F`|@fh"+h|g\ +dS|dN +lg4c^ c  b|'Fl`>Jl:_ >c.` ?c g bBl`|'Fl|pg|'Fh +p|g@b|gF`p_ ]b|'Fp`\ f|'Fp`NJlJ|'Fp|lg0`6_ ]c`_ >bBp`|'Fp|lf|'Fh`Bh +hgV|gb|g`*JA g>Hz~`(JA g0Hz`JA g"Hz` JA gHza3/aGdPO f J@g c,J@f$J+fJ+fB 9@UA@b m P f4J@f,J9@f$J+fJ+f 9@UA@b n $k(k6J+Ng*, `*,$J@g +t|e80; N$H f|'FtBx` $f |'Ft` (f |'Ft` Bt @g  b|'Ft @gd Bf r`Z (f^|'Ft` ` CfN|'Ft` P Bg Jg Tf k'h JBt` , If|'Ft k'h J|'F`` Bt`T f|'FtBx` b6BtBx|@f(B``" f|'FtBxB`` |'FxJxfJl +`|gf|gJhfJdg JfP|dfH_ >b<Dk{HnHnBDa.B.'@x k'h JPOXO`I'Dx k'h J` g W b2 g0 * b f2R * B2@ \J9@ .g J9@ 4f ` f0R * B2B9@ \J9@ .g J9@ 4f ` fR * B2@ ]` ^ fR * B2B9@ ]` < fJg 4"+Jc *$RJ2(g BAAU2(W c08f -g S bRJ2(fJ2(g `" f J |R * B2` J+g f"* bX *ЁЅй@ b$@ ^BJg 2fp"ҀJ9@ .g y@ JA ЀSo` 9@ JSnJJgJ+$gP'j J kJ`0 fK'MJSHJgJ+f kJJg J0lSH'HJ,+J fBJ/+J/ a$kPOJ+$g * @ ^й@ bf Hx/ an J DR * B2R@ b`Jl * cxJJgJ+$g8'@Jg$ kJ0 fK'MJ|f*kJ fBJ/+J/ a$kPOJ+$g * @ ^й@ bf Hx/ aPO  fB/ a|N` f<  f B/ aB+N|@fB``  f j Jg 0fK%M B2S@ ^ * ЪЅ$@ ^ й@ b",6g A`Jg(\H"(l&(`J+Ng",$o&n(`(؀ ,(R,9@ J lHza G.XO@f'j J"y@ JAl RJ f *Ѓ%@`ංo J | R * B2Rn`J+$f J9@ g@ f *Ъ &@ ^"ҹ@ b ,(R*y@ J BJ@gJxgtonJ+gFf0f(fff gZ`X` V`T`RJ9@ .g y@ JA ЀSo`> 9@ JSn2B/ a$k$+x&+tBxBtHx/ a'Bx'CtPOPO  f k'h J|@fB`J+4gV Ъ$Ԫ Ь("9@ ^ y@ JCop й@ b"J9@ .gA ЀSoL`oD ЪЪ Ь("@ ^BJ@gJxgpЁB$* g 2(fv"҃ 9@ JSoJ+g Ъ"* Ёй@ b&@ ^BJg 2ftFf@f0f$ff g" Z` X` V` T` R"Ҁ`"҂J9@ .g y@ JA ЀSo`p 9@ JSndJ,:g*Hza DJXO@g/+J/ aPO  g`HHza D XO@g J9@ .fJ9@ gJ9@ gJ9@ g  o B/ aPO f< Jl|&, $k$9@g. +xgAD|f|`g ?c g b c  bp_ ]b _ ]c fJ_ >b> +dg'@``x +h|f'F``hJg .f\._ >bN|`gF|'F``>._ ]b._ ]c f._ >b|'F``B` 9@U|g |g`|`fHnB./B./aT`._ ]b._ ]c fT._ >bFHnHnB./B./a J nR J nR POPO`BJA g&B./B./Hzga'/aGXPOPO J |=R J |=` +`|g|fBHnB./B./a J nR J nR POXO`. ?c( g" b. c\ cP J |=R J |=R JA gFB./B./Hzua&/aGWPOPO` J AR J nR Bx`t J IR J@UfLgFBAAU0f(`2 J IR g.BAAU0g /a zXO`` B/ a`< * B2g Hx/ a fR@ ^ k'h J fR@ ^L<|N^NuNV n.Jg@3N^NuNV nJg(3I`BN^NuNV n.Jg@4N^NuNVH?<(nBBBBBJgpJ gjJgdl, n"n&nG& " l l$XHXIn l ±b$*nfHx`HhHxa p*-Hf`D"n L"""""6|-KBB l4H g g W cJg *nJ-g4H c  fl "n$n&nmll\B*n mJf0&n k`( ( n"f"( n$҂!A ը PJfނl*n 8RRmXIXJRm&nH8R4H g gRR` *nH8RR m&nB38*n+C M LHza&/aGO6`*JA gHza /aGOPO/*\a^B\$nN^NustartStblTABLE: started. startStblTABLE: failed. NV/ /$n4.Jg\J\g/ aLXO2B/ a%H\XOg"JA gHzap/aGN%j`JA gHzaN/aGN^$.$nN^NuendStblTABLE: ignored. endStblTABLE: ok, will try. endStblTABLE: ncols = %d. endStblTABLE: changed %d lines, done. NV/ /$nJgJ\f JA gHzfa/aGM`JA gHz`az/aGMPO/*\a$XOJA g/HzQaN/aGM^POXOJo2// aD$POJA g/Hz
href="NVH8<*n m Jg@Jg\J m!Hx"/ "CN$HPOJg"BHx / "CN$HPOJgRJRKJgb@ L<N^NuNV"n n //a N^Nuunknown field or linkThere are only hidden links from this document.There are no references from this document.w.htmlCan't open temporary file!keystrokes/follow_help.htmlList Pagethis document:References in %s%s

olul<%s compact> Visible links:%s

  • form field = %s (internal)RelTitle: (%s) - in TYPE="internal link"
  • %s%s%s%s%s

    ol continueHidden links:

  • %s NVH?<.BBB-|8/9@ ar-@/9@ a.POJn$Jo|@ gHz`lJn JnHz`\J9@ g&< 9@K`fHzHzHyAZa*POXO`&HyAZaHzHzHyAZaf*POPOJfHzap`HyAZ$nXJ/ ajPOp < Jgp//aN@K`@ @ HzHz/a a/E/ a B/ aP$ n <JgJg /HzrHz}/EG NPOPO .g/aBXOJo6 <J@ Bf </HzJ/NPOXOJo HzHHzS/NPOXOJo |@ fBtn8C-I/a^$HXOJf4|@ Bf Hn/a_/.//Hz/aGx`/ aXO(/a-H.a&XO< Jg/.aXO&H`BgHzHnaPPO``< JgF jJg>f:Hx Hz/(aGPOXOJf j| ܨ/HzHnaPOXO` .g/aBXO//.a\POJg /anXOHx/.aOPOJgPJgL/ E/ aRHx/ aN nPOPOJgHx#/.aG4(HPO`Jg/aBXOAJgJgA/ <Jg Jg </". f ./ <g Jg </ .f </ <Bg <//.Hz/aG閼$ .g/atBXO .g/a`BXORo .g/aBBXOJo`Jo& <J@ Bf </Hzg/aGFPOXO <J@ Bf </Hz/EG NHzLHz/NBohE//9@ a// aB/ aMj nJg0Jf/`//Hz/aG镾POPO .g/avBXORn <J@ Bf </Hz/aG~/aD/apBg "n|`>"n )g/a"nBXO"n ) g/a"nB "nB)"nB)B)BL Jg/a.XO$`B/a"-AXO f / <g Jg <// Hz/aG` .g/aBXORJl4Jo&Hzj <Jo < /Hzi/aGPOPOʺo^/ /9@ a/HnaPOPO nJg2Jf/`/HrHz(/aGPOPO .g/aBXORJnLN^NuNVJ@Kpf a#@Kp/./9@Kpa"N^NuLYCgi./LYCgi.cNV/ 9@Kl@Khf\t Ԁ#@Kh"9@Kdg"@Hi0/ar#@Kd`"@Hi0ad#@Kd/anPOJ@KdfHzHza 9@Kl y@Kd! R@Kl 9@KlB $.N^Nu%s=%sNV/$./aG XOg&B//HzHna/.a,/.a$.N^NuLynxcgi capabilities are not compiled into this version.NVHza IA:"BC. G$@/4/Hz/aG6POPOQBBSd/aGL N^Nureject.datUnable to open reject file.NV/Hza$XOf HzaXO/.Hz"/aG鍶/aGx$.N^NuNV//BBBHzHzaGt&POfB`/.HzHnaPOXO/HnaPOJgTJfP/.aG4 @XOJo"n 1*frg(Hh/ /.aGPOXO`/ /.aGPOJft` .g/aBXO .g/aBXO/aG錘 $.&.N^NuBash-like BindingsAlternate BindingsDefault Bindingkeystrokes/bashlike_edit_help.htmlkeystrokes/alt_edit_help.htmlkeystrokes/edit_help.htmlNV/ .0|"tfB`J@lG`g nXA@S@0p`L g n> y@Ud0p`2 g n$ y@Uh0p` 9@KA@Ul p B0 Btf 9@KA@Ul p 0I` $.N^NuNVH0<". . *n&&CBJm^ fXnPgnBA@S@`* gn, y@Ud` gn y@Uh1p`f cB`ZJoveLA@Uh p<`8BA@UxJg,<I$HC@UlJlAJg QXJXIRJfpL< N^NuNV/".2|a 9@KA@Ul p 1If `Ntzg>t`g4t~g*tggpg R`p` <` B`p{`p "@Jlp$.N^NuNVH?<&.&n 4|8|zJg&ra 9@KA@Ul*p y@ 9@ B5I"G$ @f `N~fJ.gJJfFJgB~f89@-g`.0@g ` A@-00 gj~f B09@(|`*0@g ` A@(~00 g,~f,J.gJfJg B09@-g B09@(f `~fJl$A~fJl(A> JlJl*~zg>~`g4~~g*~g gp g R`p` <` B`p{`p "lJmh"B 9@KA@Ul p J0l y@Uh2p$Jg& @f @`~fJ9@ gNJ9@ fFJgB~f89@-g`.0@g ` A@-00 gp~f B09@(|`*0@g ` A@(~00 g2~f6J9@ gJ9@ fJg B09@-g B09@(f @`~zg>~`g4~~g*~g gp g R`p` <` B`p{`p "lJmLJg&ra9@ 9@ BA@S@2p$ @f @@`n~fJgJJfFJgB~f89@-g`.0@g ` A@-00 gh~f B09@(|`*0@g ` A@(~00 g*~f.JgJfJg B09@-g B09@(f @@`~zg>~`g4~~g*~g gp g R`p` <` B`p{`p "lJmJJg&ra9@ 9@ B y@Ud2p$ @f @ `~fJgJJfFJgB~f89@-g`.0@g ` A@-00 gh~f B09@(|`*0@g ` A@(~00 g*~f,JgJfJg B09@-g B09@(f @ `V~zg>~`g4~~g*~g gp g R`p` <` B`p{`p "lJg~&pL-&YENyue*pss^3^2^1S:(R)>>-L-+-P:oe-o-aonNOT.u<<?`i!i 3/4 1/4 1/2dhe/DEGCUR(c)-c-,c|`aae'aYUeUPOeONIEDHDjCAeAAE7 bit approximations (US-ASCII)Western (ISO-8859-1)us-asciiiso-8859-1euc-cneuc-jpshift_jiseuc-krbig5ONOFFHTMLSetCharacterHandling: LYRawMode changed %s -> %s HTMLSetCharacterHandling: UCLYhndl_for_unspec changed %d -> %d NVH? &./9@ @aŰ(9CGV,9@r A@[XO~gB@B@Uf @ >CGV`J9@ >WDCGVB A@[0f0g<@J9CGVgA@b <_D@`B9@J9CGVffA@b <_`B9@`$0Hzx/EG!NPOJf~`THzg/NPOJf ~#@`DHzV/NPOJf ~#@~`*HzF/NPOJf~`Hz;/NPOJf~#@~#@UJ9@ >fB@ 9@VDCGVB9@B9@JVD@B9@J9CGVg#@r`2g$ A@[~f 뀾g#@r` #@z@r 9@UA@b ^ID/aXOJA gl9CGVg:"<mJg"<j/ <mJg <j/HzQaN/aGPOPO 9@rgJA g//Hz[aN^/aGnLN^NuNVH0 $.&. J9CGVgHz/EG!NPOJgHz/NPOJf(Hz/NPOJgHz/NPOJf r#@`Hzz/EG!NPOJfHzf/NPOJf r#@`\Hzm/EG!NPOJfHzY/NPOJf r#@`0Hz:/EG!NPOJfHz&/NJf r#@`B@L N^NuNV .A@[rWDCH*N^NuNV//&.. A@[rg/9@ @agJWD@ >`@ >$.&.N^NuNV .A@[rWD@UN^NucpwindowsNVH 0 .J9@Ug @U`LHxHz$G@[/3(E +NPOXOJfHxHz/3(NJf <J9@ EgB@UL N^Nu;piaFRMBT;^-e2wq`qLF4.zmZM:- tiTI=1# mnemonicRFC 1345 Mnemonicmnemonic+ascii+0RFC 1345 w/o Introutf-8UNICODE UTF 8iso-8859-10ISO 8859-10iso-8859-9ISO 8859-9 (Latin 5)iso-8859-8ISO 8859-8 Hebrewiso-8859-7ISO 8859-7 Greekiso-8859-6ISO 8859-6 Arabiciso-8859-5ISO 8859-5 Cyrilliciso-8859-4ISO Latin 4iso-8859-3ISO Latin 3windows-1257WinBaltRim (cp1257)windows-1256WinArabic (cp1256)windows-1255WinHebrew (cp1255)windows-1253WinGreek (cp1253)windows-1251WinCyrillic (cp1251)windows-1250WinLatin2 (cp1250)cp862DosHebrew (cp862)cp869DosGreek2 (cp869)cp775DosBaltRim (cp775)cp737DosGreek (cp737)cp864DosArabic (cp864)cp866DosCyrillic (cp866)PC Latin2 CP 852cp852DosLatin2 (cp852)IBM PC codepage 850cp850DosLatin1 (cp850)IBM PC character setcp437DosLatinUS (cp437)x-transparentTransparent7 bit approximationsvisciiVietnamese (VISCII)Taipei (Big5)KoreanJapanese (SJIS)Japanese (EUC)Chinesekoi8-rKOI8-R CyrillicnextNeXT character setmacintoshMacintosh (8 bit)dec-mcsDEC Multinationalwindows-1252WinLatin1 (cp1252)iso-8859-2ISO Latin 2ISO Latin 1NVH 8$./avXOJfp`^ `Z/4`NG@Z g//aGx^POJgXKRJr;lAJg(H$L//aGx6POJgPJPKJf/aLN^NuyumlthornyacuteuumlucircuacuteugraveoslashdivideoumlotildeocircoacuteograventildeethiumlicirciacuteigraveeumlecirceacuteegraveccedilaeligaringaumlatildeacircaacuteagraveszligTHORNYacuteUumlUcircUacuteUgraveOslashtimesOumlOtildeOcircOacuteOgraveNtildeETHIumlIcircIacuteIgraveEumlEcircEacuteEgraveCcedilAEligAringAumlAtildeAcircAacuteAgraveiquestfrac34frac12frac14raquoordmsup1cedilmiddotparamicroacutesup3sup2plusmndeghibarregshynotlaquoordfcopyumlsectbrvbaryencurrenpoundcentiexclnbspNV .mr_lA` A@c p N^Nutmie#_YS L#HC?:'3/"( " "  ! Jַֻ-ֲ֢֖֚֮֨֒$֍ևրy"soj g"c`"kY*S$L&GA2<62,'0#*. (4% 6 վ9շղ!ի=դ;ՠ՜ՙ"Ւ?ՋAՈ"jՄՀ}x qCjGcE_[XRRKF@<5P1+L%  3T!XV )(,ԺZԳ`Ԭ^Ԧ\Ԣ!ԞԘԔ"Ԑ"gԋԅ Ԁ&|udnbj"f`YfSMFlyB#;p51+j%r n ht" "t/.mv+xӼyӵ}ӱӬ{ӧӣӝSӖMnӒ05ӎZӆ!5Ӏ!5ztn"j&f"'b" \"U"!N""H!+B?"H;"J6;2*,"HFA$ ҺҲҪҤҜғҌ҄{rmh`YRMGA;4,# ""L1 "5" !,!6ѿѹ$#ѳ%ѭ%ѧ%ѡ%њ"ѓ"э%Wч%Tс%V{%Sv%Pp%fj%id%d^%gX%]R%ZL%\F%YA%Q;%l5%c/%`)%k#%b%_%U%R %% %%e%h%,%4%[%X%%%%jп%aй%^г%<Э%$Ч%Р 5КГЎ"=Ј"Ѓ\~ "y"Ns"Olh")b A\U .O J VEG?';7%2-"W'&c!:"T, @"""E"."!!'""!"*Ͼ"|Ϸ!ϱ"ϫ"Ϧ!ϟ Ϙ!8ϓ!ύ!ψ ς"|uq4kga![!V"P&fLE"@R:!3#,# %$!!# # U%%_"Q "V"UMξθ"Rδ'ΰ"ά!Ψ"΢Λ Ε"ΐ Ή ΂ { wKr lg_Y" R=L"aF"S@"P<7 2!,"(D!&@ &m""8!S?!U!Y![!T!V1ͺ!Wͳ!\ͬ!Xͥ!Z͞!]͗!^͑ D͋#"͈"ǵ{tmf#`\3W!T"eP"L"eHB!7=S:"w6"i2"i,"&` ""s>"i! ! J!!%&e & ' C̹-̳̯8̨̢̝5̙!̏̕3̉+̃!|!v"o1k"+d"_QY/T*O"H)BV<5891X+T%7:8E\!!"f:!#)!!˿!˸!˱!˪>ˣ<˝#˘{˔;ˏ"ˉ ˂ "d{"w"dp# m"vic!]!W%RYK@G"hC"h="6"/_+%&'&!(!!  9!"r[  B<""%"%ʿ"hʺʵ&Bʰ' ʬ!ʥ%ʡ<ʛ ʗhʓ"#\ʍ"ʆ"ʁ &z"s"pj"c"\"V"ODK"IEI?&n8H1F+"G'=! "`!"b ""q"q"o!!" Z!! %"p"p"n"ɺ"ɵ"$ɯ" ɪ"&ɦ"ɡ"ɛ!ɕ!ɏ"Ɉ"Ʉ""z"At"Dn"&i"c"]"X"R"L"IE#>!8 1"*"$!!$"" >"Q"S!&! >Mȼȵ"ȯ"Ȭ"(Ȧ!Ƞ!4Lț"Ȕ"Ȑ"%cȋ"ȇ?Ȁ%y.r 0m"id`[VO!3I&FB;!6+0")"~&"z""| 2"" ""~ ?"!!U"#*F!!ǻ!Ǵ!ǭ!ǧ!ǠYǙWǓ# ǎ}NJ@DŽ } x!s%l# hb!\!XSNG!@!< 7)0 :,!']!  " "%"%![" \"{a"}"}_ƽ]ƶ"ư"ƬAƧ"ơ"Ɯ;Ɩ"Ƒ'6ƌƅ#"Ɓ{&otIoHib[W"<R"CL##ELA/:&`5"%/")"#"""" %%%"##"&&""""""ż&jŸ"Qytų"Ů"Ũ"Ţ"aś#ŗŐeʼncŅBŀ y#un"4haXQLE ?"H8"<2+"'" 4!""\F [g"l!!!^mCqľĸ!IJ!Ĭ%ĥ#Ğ#ĘkĒsČ"ćāyr#k#eo^iY%S%N!H"C!?29"2"+"$|" 2" """""u"Y!"@%%þ!ø!õï!é!ã%ÞOØwÔKÏWÊNÃz|~x7s|nje6a \ zwnjzwjzhcyzgrzetazdotzcyzcaronzacuteyucyyicyycyycircyacyxutrixrArrxlArrxixharrxhArrxgrxdtrixcircwreathweierpwedgeqwcircvsupnevsupnEvsubnevsubnEvrtrivpropvprimevltriverbarvellipveebarvdashvcyvarrvDashvArrutrifutriutildeuringurcropurcornupsilonupsihupsiuplusuogonumacrulcropulcornuhblkuharruharlugrudigrudiagrudblacucyubreveubrcyuarr2uarruacgruArrtwixttstroktshcytscytrietradetprimetoptimesbtildethksimthkapthinspthgrthetavthetasymthetasthetathere4tgrtelrectdottcytcediltcarontautargetsupnesupnEsupesupEsupsungsumsubnesubnEsubesubEsubstarfstarsstarfssmilessetmnsqufsquaresqusqsupesqsupsqsubesqsubsqcupsqcapsparspadessolsoftcysmilesimesimsigmavsigmafsigmashcyshchcysharpsgrsfrownsfgrsextsetmnsemisdotbsdotscyscsimscnsimscircscedilscesccuescaronscsbsolsbquosamalgsacuterxrtrifrtriertrirtimesrthreersquorrsquorsqbrshrsaquorparrlmrlhar2rlarr2ringrhovrhorharurhardrgrrfloorrectrealrdquorrdquorcyrcubrceilrcedilrcaronrarrwrarrtlrarrlprarrhkrarr2rarrrangradicracuterArrrAarrquotquestpuncsppsipsgrprsimpropprodprnsimprimepreprplusdoplusbplusplanckpivpiphonephmmatphivphisphiphgrpgrperppermilperiodpercntpcypartparotimesosolorderorarroroplusominusomicronomegaomacrolineolarrohmohgrohacgrogrogonoeligodotodblacodashocyociroastoacgroSnwarrnvdashnvDashnumspnumeronumnunsupensupEnsupnsubensubEnsubnsparnsimensimnscenscnrtrienrtrinrarrnrArrnprenprnparnotinnmidnltrienltrinltnlesnlenldrnlarrnlArrnjcyninharrnhArrngtngrngesngenexistnequivnearrnendashncyncongncedilncaronnaturnaposnapnacutenablanVdashnVDashmumapmumodelsmnplusmldrminusbminusmidmgrmdashmcymarkermapmaltmalemacrlvnEltrifltrieltriltimeslthreeltlstroklsquorlsquolsqblsimlshlsaquolrmlrhar2lrarr2lparlozflozlowbarlowastlnsimlnelnElmidotljcylhblklharulhardlgrlglfloorleslegleldquorldquoldotlcylcublceillcedillcaronlarrtllarrlplarrhklarr2larrlanglambdalagranlacutelElArrlAarrkjcykhgrkhcykgreenkgrkcykcedilkappavkappajukcyjsercyjcyjcirciukcyitildeisiniotaiogoniocyintcalintinodotinfinincareimageimacrijligigriffiecyidigridiagricyiacgrhyphenhybullhstrokhorbarhellipheartshcircharrwharrhardcyhamilthalfhairsphArrgvnEgtgsimgsdotgravegnsimgnegnEglgjcygimelggrgesgelgegdotgcygcircgcedilgbrevegammadgammagacutegEfrownfraslfrac78frac58frac56frac45frac38frac35frac25frac23frac18frac16frac15frac13forkforallfnofflligflatfiligfflligffligffiligfemalefcyexistexcleuroetaesdoterDotequivequalsepsisepsilonepsieogonenspengendashemsp14emsp13emspemptyemdashemacrelsellegsegrefDoteegreeacgredotecyecolonecirecaroneacgreDotdzcydtrifdtridstrokdscydrcropdrcorndrarrdotdollardlcropdlcorndlarrdjcydivonxdiediamsdiamdharrdharldgrdeltadcydcarondblacdashvdashdarr2darrdalethdaggerdArrcuwedcuveecurarrcuprecupcularrcuesccueprcrosscrarrcopysrcoprodconintcongcompfncompcommatcommacolonecolonclubscirecirccirchicheckchcycdotccircccaroncaroncaretcapcacutebumpebumpbullbsolbsimebsimbrkbarbrevebprimeboxvrboxvlboxvhboxvRboxvLboxvHboxvboxurboxulboxuRboxuLboxhuboxhdboxhUboxhDboxhboxdrboxdlboxdRboxdLboxVrboxVlboxVhboxVRboxVLboxVHboxVboxUrboxUlboxURboxULboxHuboxHdboxHUboxHDboxHboxDrboxDlboxDRboxDLbowtiebottomblockblk34blk14blk12blankbgrbethbetabernoubepsibecausbdquobcybcongbarwedb.zetab.xib.upsib.thetavb.thetasb.taub.sigmavb.sigmab.rhovb.rhob.psib.pivb.pib.phivb.phisb.omegab.nub.mub.lambdab.kappavb.kappab.iotab.gammadb.gammab.etab.epsivb.epsisb.epsib.deltab.chib.betab.alphab.Xib.Upsib.Thetab.Sigmab.Psib.Pib.Phib.Omegab.Lambdab.Gammab.Deltaasympastaposapeapaogonangstangsphangmsdang90angandampamalgamacralphaalephalefsymagracyabreveaacgrZgrZetaZdotZcyZcaronZacuteZHcyYumlYcyYcircYUcyYIcyYAcyXiXgrWcircVvdashVerbarVdashVcyUtildeUringUpsilonUpsiUogonUmacrUgrUdigrUdblacUcyUbreveUbrcyUacgrTstrokThetaTgrTcyTcedilTcaronTauTScyTSHcyTHgrSupSubSigmaSgrScyScircScedilScaronSacuteSOFTcySHcySHCHcyRhoRgrRcyRcedilRcaronRarrRacutePsiPrimePiPhiPgrPcyPSgrPHgrOmicronOmegaOmacrOgrOdblacOcyOacgrOHgrOHacgrOEligNuNgrNcyNcedilNcaronNacuteNJcyMuMgrMcyLtLstrokLmidotLlLgrLcyLcedilLcaronLarrLambdaLacuteLJcyKgrKcyKcedilKappaKJcyKHgrKHcyJukcyJsercyJcyJcircIukcyItildeIotaIogonImacrIgrIdotIdigrIcyIacgrIOcyIJligIEcyHstrokHcircHARDcyGtGgrGgGdotGcyGcircGcedilGbreveGammaGJcyFcyEtaEpsilonEogonEmacrEgrEdotEcyEcaronEacgrENGEEgrEEacgrDstrokDotDotDotDgrDeltaDcyDcaronDaggerDZcyDScyDJcyCupChiCdotCcircCcaronCapCacuteCHcyBgrBetaBcyBarwedAogonAmacrAlphaAgrAcyAbreveAacgrNVH<8(nBJgJf B`JB:3(`@B(<G^ $C/ A $Ԃ/3(aGIPOJgl& R`( e L/aGH$HPOJg RLAJfJf JfJg/aGH" @G CHqHxaa$$BPOXOfHz Hza~PO UJgR &f&amp;`.Jg( f&gt;`RHJfB g /a[B*L< N^NuNV"nBJg>g: b I gRHRg cJoBJ1gARJfB1N^NuNV/ $nJg(Jg$/ aGGSkA  bBSHQB@Sd$nN^Nu<--tel*1*2CiBdFdIcSn0R0L0M0o0mLZDwDbTl<|dTTr|>uTOrSRsBRXRKRZRHRYRFRrROOSfS?S:S.SRBlBFBLBTB\0-oz-oy-ox-ow-ov-ou-ot-os-or-oq-op-oo-on-om-ol-ok-oj-oi-oh-og-of-oe-od-oc-ob-oa-oZ-oY-oX-oW-oV-oU-oT-oS-oR-oQ-oP-oO-oN-oM-oL-oK-oJ-oI-oH-oG-oF-oE-oD-oC-oB-oA-o(z)(y)(w)(v)(u)(t)(s)(r)(q)(p)(n)(m)(l)(k)(j)(i)(h)(g)(f)(e)(d)(b)(a)20.19.18.17.16.15.14.13.12.11.10.9.8.7.6.5.4.3.2.1.(20)(19)(18)(17)(16)(15)(14)(13)(12)(11)(10)(9)(8)(7)(6)(5)(4)(3)(2)(1)20-o19-o18-o17-o16-o15-o14-o13-o12-o11-o10-o9-o8-o7-o6-o5-o4-o3-o2-o1-o4j3j2j1j4h2h3h1hVs/>7<>7<7Eh.3:3>>><<<>.<. DOT NAND XOR INTERCALATE MULTIMAP CONTAINS AS NORMAL SUBGROUP OR EQUAL TO NORMAL SUBGROUP OF OR EQUAL TO CONTAINS AS NORMAL SUBGROUP NORMAL SUBGROUP OF !FORCES NOT TRUE !PROVES FORCES TRUE MODELS -T[.][x][-][+](=)(*)(o)(.)(/)(x)(-)(+))_(_ !)C !(C )C(C >< <> !>!<.GT.NOT.EQ..LT.NOT.EQ..GE..LE.>==< !=3 =3!==::=HI=? !~= ~=?=?-CG?1:R:..:IoDI\int )U(UORAND !PP PP-V-Linfty0( ROOT4 ROOT3 SQRT sbOb* - .+-/+ -\sum\prod qed!-)-)!(-(-NablaDelta{}\partialFA<=>vv=>^^<=>VRETUD-//>-v->-^<-10000R5000R1000RCDxiiixviiiviiiviiiXIIXIIXVIIIVIIVIIVIII 1/ 7/8 5/8 3/8 1/8 5/6 1/6 4/5 3/5 2/5 1/5 2/3 1/3Dalet Gimel Bet Aleph est.Ang.Ohm(TM)TEL(SM)RxRePONo.Im\hbar oFc/uc/ooCa/sa/cEURW=PtLiFf)(_=_-_+_9_8_7_6_5_4_3_2_1_0^n^)^(^=^-^+^9^8^7^6^5^4^0!??!/'-!!:X><```''' 0/00 ..... o /=/-=2--(<-)(->) ;;!*!:Rhrh?;;';!?,,',!?:?*,,hUhOhIhA~A~hA'h`A`AhAha~a~ha'h`ay?Y?y2Y2y-.Y-.y!Y!u9-.U9-.u9?U9?u92U92u9!U9!u9'U9'u2U2u-.U-.o9-.O9-.o9?O9?o92O92o9!O9!o9'O9'o>-.O>-.o>?O>?o>2O>2o>!O>!o>'O>'o2O2o-.O-.i-.I-.i2I2e>-.E>-.e>?E>?e>2E>2e>!E>!e>'E>'e?E?e2E2e-.E-.a(-.A(-.a(?A(?a(2A(2a(!A(!a('A('a>-.A>-.a>?A>?a>2A>2a>!A>!a>'A>'a2A2a-.A-.y0w0t:h_z_Z_z-.Z-.z>Z>y.Y.x:X:x.X.w-.W-.w.W.w:W:W'w!W!v-.V-.v?V?u-:U-:u?'U?'u->U->u-?U-?u--:U--:t->T->t_T_t-.T-.T.s.-.S.-.s<.S<.s'.S'.s-.S-.S.r_R_r--.R--.r-.R-.R.p.P.p'P'o-'O-'o-!O-!o?:O?:o?'O?'n->N->n_N_n-.N-.N.m-.M-.m.M.m'M'l->L->l_L_l--.L--.l-.L-.k_K_k-.K-.k'K'i:'I:'i-?I-?h-(H-(h,H,h:H:h-.H-.h.H.g-G-f.F.e,(E,(e-?E-?e->E->e-'E-'e-!E-!d->D->d,D,d_D_d-.D-.D.c,'C,'b_B_b-.B-.b.B.a-0A-0`10000`100`90`80`70`60`50`40`30`20`10`9`8`7`6`5`4`3`2`1:|:`?:-;::fYarYamYapWapopEpapipupefWafofEfifufa`So`S`SE`Si`Su`SaSWoSWSWESWaSWiSWuSWePWaPoPEPaPiPuPeCWaCoCECuCaCeTWaToTETaTiTuTeGWaGoGEGaGiGuGegWgWEgWagWigWugogEgigugajWajojEjajijujeDWaDoDEDaDiDuDedWadodEdadidudeyWayoyEyeZWaZoZEZaZiZuZezWazozEzazizuze`o`I`uwowEwawiwuweKWKWEKWaKWiKWeKoKEKaKiKuKekWkWEkWakWikWekokEkakikukee3NWaNoNENaNiNuNenWanonEninunahWhWEhWahWihWe`ho`h`hE`ha`hi`hu`hecWacocEcacicucetWatotEtatitutevWavovEvavivuvebWabobEbabibubeQWQWEQWaQWiQWeQoQEQaQiQuQeqWqWEqWaqWiqWeqoqEqaqiquqexWaxoxExaxixuxesWasosEsasisuserWarorErarirure`sWa`so`s`sE`sa`si`su`semWamomEmamimumeHWaHoHEHaHiHuHelWalolElalilulehohEhahihuhegfv+zjtchHp+aS9a8a7a6a5a4a3a2a1a0a0+3+1+'+/+=+"+:+y+j+w+h+n+m+l+k+q+f+++i+e+zHtjddc+sns+z+r+dkd+x+hkg+tkt+tmb+a+yHahwHaHaMH'?+;+,+T+ShR+Q+ZJZjP+P%E+S+N+N%M+M%L+K+K%J+TjX+Z+W+H+D+G+B+eyoyg3G3c3C3v3V3f3F3o3O3y3Y3dzv%kjnjljj%yiiidsieg%d%ioyayu`eschshchhzhvYAYU`ESCHSHCHHZHVIODZV%KJTsNJLJJ%YIIIDSIEG%D%rho kappa p3P3k3K3m3M3t3T3k.pi phi upsi theta beta w%u%o'v*jwqxfts*srpocnmlkiyzedgbau3i'y%e'a'V*JW*QXFUTSRPOCNMLKIYEDGBAi3W%U%O'I'Y%E'.*A''*?%~~=j3'%```||''_v_B_L_M_H_T'"~';'0'.'(:\1!1-'<^;StStsd3q`k!G`bp!c!l!HZz.I.l^wrt.t!J`s.g"r"*.r.*&.@.n"n.ju-zi"hjo-g`RV"@d`d.b`A.u)U)u!!U!!r)R)r!!R!!o)O)o!!O!!i)I)i!!I!!e)E)e!!E!!a)A)a!!A!!o/'O/'ae'AE'aa'AA'ezEZo1O1g/G/a3A3a7A7a1A1u:!U:!u:<U:<u:'U:'u:-U:-EDz/Z/u9U9yroiOIo9O9k2K2 fF2c2C2s1u"U"t/T/OEo"O"NG'nl/L/l.L.kkijIJH/d/D/thueo/-:oed-`ic,aaae`assTHUeO/ *OeD-C,AEAAAe? 3/4 1/2 1/4>>-o^1,.P:u'^3^2+-DEG-(R)NOT<<-a(c)"S:|YENCUR-L--c-! @f !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~RxSy'dhY'DH@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `ax % !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~   ''@v !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~A=Z`(^dy}{ (B>[ 'aH_ez ~6|T9 'CGPXnpbU: GDHQYoqc []()@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~&$0^4{'%1_5|  l\  !m] !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~8V(;`"f}W)<a#gJ~K. *EL6rhj/ +FM7sik !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~0    } !"#$%&' (`)*+,-./0123456~789:;<=>?@ABCDEFG HaIJK1LMNO!QRSTUVWXYZ[\^_````@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:@ABCDEFGHIJKLMNOPQR !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ q r  '$%qsuwc1y{}d ! @ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ > @  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHI+JKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ '0^(1K_H@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~"*(6;CV`f}8J#+)7<DWag~ K. ELhrj/ FMisk@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ `a}}RSx !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%% %%%%%$%,%4%<%%%%%%%%# %"""H"d"e#! '%P%Q%RQ%S%T%U%V%W%X%Y%Z%[%\%]%^%_%`%a%b%c%d%e%f%g%h%i%j%k%lN01F45D3E89:;<=>?O@ABC6~2LK17HaMIG J.&$%/ !"#},+(`-)' * !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ "!""`""d"e""""+!&""H" &RS      %x D 9 : ! '   01@&AC&PM&OC&ST&CI&SC&GC&SS&EG&SG&MW&CC&TS&P2&P1&DC&S3&S2&RI&PU&PD&VS&HJ&HS&ES&SA&NL&IN&NH&BH&HO&PA&DT&US&RS&GS&FS&EC&SB&EM&CN&EB&SY&NK&D4&D3&D2&D1&DL&SI&SO&CR&FF&VT&HT&BS&BL&AK&EQ&ET&EX&SX&SH&NU&_la._&_la-_&_lh._&_lh-_&_lH._&_lH-_&_lM._&_lM-_&_y+._&_y+;_&_y+,_&_y+-_&_j+._&_j+-_&_w+._&_w+-_&_h+._&_h+;_&_h+,_&_h+-_&_n+._&_n+;_&_n+,_&_n+-_&_m+._&_m+;_&_m+,_&_m+-_&_l+._&_l+;_&_l+,_&_l+-_&_k+._&_k+;_&_k+,_&_k+-_&_q+._&_q+;_&_q+,_&_q+-_&_f+._&_f+;_&_f+,_&_f+-_&_i+._&_i+;_&_i+,_&_i+-_&_e+._&_e+;_&_e+,_&_e+-_&_zH._&_zH;_&_zH,_&_zH-_&_tj._&_tj;_&_tj,_&_tj-_&_dd._&_dd;_&_dd,_&_dd-_&_c+._&_c+;_&_c+,_&_c+-_&_sn._&_sn;_&_sn,_&_sn-_&_s+._&_s+;_&_s+,_&_s+-_&_z+._&_z+-_&_r+._&_r+-_&_dk._&_dk-_&_d+._&_d+-_&_x+._&_x+;_&_x+,_&_x+-_&_hk._&_hk;_&_hk,_&_hk-_&_g+._&_g+;_&_g+,_&_g+-_&_tk._&_tk;_&_tk,_&_tk-_&_t+._&_t+;_&_t+,_&_t+-_&_tm._&_tm-_&_b+._&_b+;_&_b+,_&_b+-_&_a+._&_a+-_&_aH._&_aM._&_3+;_&st&ft&_ffl_&_ffi_&fl&fi&ff&_KSC_&_10c_&9c&8c&7c&6c&5c&4c&3c&2c&1c&_(JU)_&gn&nG&v4&iu&u4&i4&er&eN&aN&en&an&ou&au&ei&ai&_eh4_&e4&o4&a4&s4&c4&z4&r4&sh&ch&zh&x4&q4&j4&h4&k4&g4&l4&n4&t4&d4&f4&m4&p4&b4&+6&*6&-6&.6&Vo&Ve&Vi&Va&KE&KA&Vu&N6&Wo&We&Wi&Wa&WA&Ro&Re&Ru&Ri&Ra&Yo&YO&Yu&YU&Ya&YA&Mo&Me&Mu&Mi&Ma&Po&Bo&Ho&Pe&Be&He&Pu&Bu&Hu&Pi&Bi&Hi&Pa&Ba&Ha&No&Ne&Nu&Ni&Na&Do&To&De&Te&Du&Tu&TU&Di&Ti&Da&Ta&Zo&So&Ze&Se&Zu&Su&Zi&Si&Za&Sa&Go&Ko&Ge&Ke&Gu&Ku&Gi&Ki&Ga&Ka&O6&o6&E6&e6&U6&u6&I6&i6&A6&a6&+5&*5&05&"5&vu&n5&wo&we&wi&wa&wA&ro&re&ru&ri&ra&yo&yO&yu&yU&ya&yA&mo&me&mu&mi&ma&po&bo&ho&pe&be&he&pu&bu&hu&pi&bi&hi&pa&ba&ha&no&ne&nu&ni&na&do&to&de&te&du&tu&tU&di&ti&da&ta&zo&so&ze&se&zu&su&zi&si&za&sa&go&ko&ge&ke&gu&ku&gi&ki&ga&ka&o5&O5&e5&E5&u5&U5&i5&I5&a5&A5&_=T:)_&-?&)I&(I&)'&('&=_&=T&)"&("&>"&<"&>'&<'&>+&<+&0_&;_&*_&+_&+"&._&,_&IS&-X&XX&OK&MX&Mx&Mb&_M16_&M2&M8&Md&_cC-_&_cD-_&_cH-_&_cS-_&cC&cD&cH&cS&Ml&Fm&SU&0U&0u&>H&&&7<&>7&<7&Eh&.3&:3&.P&-T&02&0.&)_&(_&)C&(C&!>&!<&*>&<*&>=&=<&=3&!=&HI&=?&?2&?=&?-&CG&?1&::&:R&:.&.:&Io&DI&In&)U&(U&OR&AN&PP&-V&-L&00&0(&RT&Sb&Ob&*-&-+&-2&+Z&*P&-)&(-&NB&DE&/0&TE&dP&FA&==&=>&<=&__&_//>_&_&-v&->&-!&<-&_10000R_&_5000R_&_1000RCD_&_1000r_&_500r_&_100r_&_50r_&cr&br&ar&9r&8r&7r&6r&5r&4r&3r&2r&1r&_1000R_&_500R_&_100R_&_50R_&cR&bR&aR&9R&8R&7R&6R&5R&4R&3R&2R&1R&78&58&38&18&56&16&45&35&25&15&23&13&AO&Om&TM&SM&Rx&PO&N0&oF&co&oC&W=&Pt&Li&)s&(s&=s&-s&+s&9s&8s&7s&6s&5s&4s&3s&2s&1s&0s&nS&)S&(S&=S&-S&+S&9S&8S&7S&6S&5S&4S&0S&/f&'-&_!*2_&:X&>1&<1&Ca&3"&2"&1"&3'&2'&1'&%0&..&/=&/-&9"&:9&"9&"6&9'&.9&'9&'6&=2&!2&-3&-M&-N&-1&1H&1T&6M&4M&3M&1M&1N&?:&!:&?,&?;&,!&;!&,'&;'&y?&Y?&y2&Y2&_y-._&_Y-._&y!&Y!&_u9-._&_U9-._&_u9?_&_U9?_&_u92_&_U92_&_u9!_&_U9!_&_u9'_&_U9'_&u2&U2&_u-._&_U-._&_o9-._&_O9-._&_o9?_&_O9?_&_o92_&_O92_&_o9!_&_O9!_&_o9'_&_O9'_&_o>-._&_O>-._&_o>?_&_O>?_&_o>2_&_O>2_&_o>!_&_O>!_&_o>'_&_O>'_&o2&O2&_o-._&_O-._&_i-._&_I-._&i2&I2&_e>-._&_E>-._&_e>?_&_E>?_&_e>2_&_E>2_&_e>!_&_E>!_&_e>'_&_E>'_&e?&E?&e2&E2&_e-._&_E-._&_a(-._&_A(-._&_a(?_&_A(?_&_a(2_&_A(2_&_a(!_&_A(!_&_a('_&_A('_&_a>-._&_A>-._&_a>?_&_A>?_&_a>2_&_A>2_&_a>!_&_A>!_&_a>'_&_A>'_&a2&A2&_a-._&_A-._&y0&w0&t:&h_&z_&Z_&_z-._&_Z-._&z>&Z>&y.&Y.&x:&X:&x.&X.&_w-._&_W-._&w.&W.&w:&W:&w'&W'&w!&W!&_v-._&_V-._&v?&V?&_u-:_&_U-:_&_u?'_&_U?'_&_u->_&_U->_&_u-?_&_U-?_&_u--:_&_U--:_&_t->_&_T->_&t_&T_&_t-._&_T-._&t.&T.&_S.-._&_s<._&_S<._&_s'._&_S'._&_s-._&_S-._&s.&S.&r_&R_&_r--._&_R--._&_r-._&_R-._&r.&R.&p.&P.&p'&P'&_o-'_&_O-'_&_o-!_&_O-!_&_o?:_&_O?:_&_o?'_&_O?'_&_N->_&n_&N_&_n-._&_N-._&n.&N.&_m-._&_M-._&m.&M.&m'&M'&_l->_&_L->_&l_&L_&_l--._&_L--._&_l-._&_L-._&k_&K_&_k-._&_K-._&k'&K'&_i:'_&_I:'_&_i-?_&_I-?_&_h-(_&_H-(_&h,&H,&h:&H:&_h-._&_H-._&h.&H.&g-&G-&f.&F.&_e,(_&_E,(_&_e-?_&_E-?_&_e->_&_E->_&_e-'_&_E-'_&_e-!_&_E-!_&_d->_&_D->_&d,&D,&d_&D_&_d-._&_D-._&d.&D.&_c,'_&_C,'_&b_&B_&_b-._&_B-._&b.&B.&_a-0_&_A-0_&9a&8a&7a&6a&5a&4a&3a&2a&1a&0a&gf&v+&p+&aS&0+&3+&1+&'+&/+&=+&"+&:+&y+&j+&w+&h+&n+&m+&l+&k+&q+&f+&++&i+&e+&zH&tj&dd&c+&sn&s+&z+&r+&dk&d+&x+&hk&g+&tk&t+&tm&b+&a+&yH&ah&wH&aH&aM&H'&?+&;+&,+&T+&Sh&R+&Q+&ZJ&Zj&P+&P%&E+&S+&N+&N%&M+&M%&L+&K+&K%&J+&Tj&X+&Z+&W+&H+&D+&G+&B+&A+&g3&G3&c3&C3&v3&V3&f3&F3&o3&O3&y3&Y3&dz&v%&kj&ts&nj&lj&j%&yi&ii&ds&ie&g%&d%&io&ja&ju&je&%'&y=&='&sc&s%&c%&c=&h=&f=&u=&t=&s=&r=&p=&o=&n=&m=&l=&k=&j=&i=&z=&z%&e=&d=&g=&v=&b=&a=&JA&JU&JE&%"&Y=&="&Sc&S%&C%&C=&H=&F=&U=&T=&S=&R=&P=&O=&N=&M=&L=&K=&J=&I=&Z=&Z%&E=&D=&G=&V=&B=&A=&DZ&V%&KJ&Ts&NJ&LJ&J%&YI&II&DS&IE&G%&D%&IO&j3&'%&p3&P3&k3&K3&m3&M3&t3&T3&,G&'G&w%&u%&o%&v*&j*&w*&q*&x*&f*&u*&t*&s*&*s&r*&p*&o*&c*&n*&m*&l*&k*&i*&h*&y*&z*&e*&d*&g*&b*&a*&u3&i%&y%&e%&a%&V*&J*&W*&Q*&X*&F*&U*&T*&S*&R*&P*&O*&C*&N*&M*&L*&K*&I*&H*&Y*&Z*&E*&D*&G*&B*&A*&i3&W%&U%&O%&I%&Y%&E%&A%&'"&';&'0&'.&'(&'<&;S&_o/'_&_O/'_&_ae'_&_AE'_&_aa'_&_AA'_&g'&G'&j<&ez&EZ&o1&O1&o;&O;&k<&K<&g<&G<&g/&G/&a3&A3&a7&A7&a1&A1&_u:!_&_U:!_&_u:<_&_U:<_&_u:'_&_U:'_&_u:-_&_U:-_&u<&U<&o<&O<&i<&I<&a<&A<&ED&z/&Z/&u9&U9&yr&oi&OI&o9&O9&z<&Z<&z.&Z.&z'&Z'&Y:&y>&Y>&w>&W>&u;&U;&u"&U"&u0&U0&u(&U(&u-&U-&u?&U?&t/&T/&t<&T<&t,&T,&s<&S<&s,&S,&s>&S>&s'&S'&r<&R<&r,&R,&r'&R'&oe&OE&o"&O"&o(&O(&o-&O-&ng&NG&'n&n<&N<&n,&N,&n'&N'&l/&L/&l.&L.&l<&L<&l,&L,&l'&L'&kk&k,&K,&j>&J>&ij&IJ&i.&I.&i;&I;&i(&I(&i-&I-&i?&I?&h/&H/&h>&H>&g,&G,&g.&G.&g(&G(&g>&G>&e<&E<&e;&E;&e.&E.&e(&E(&e-&E-&d/&D/&d<&D<&c<&C<&c.&C.&c>&C>&c'&C'&a;&A;&a(&A(&a-&A-&y:&th&y'&u:&u>&u'&u!&o/&-:&o:&o?&o>&o'&o!&n?&d-&i:&i>&i'&i!&e:&e>&e'&e!&c,&ae&aa&a:&a?&a>&a'&a!&ss&TH&Y'&U:&U>&U'&U!&O/&*X&O:&O?&O>&O'&O!&N?&D-&I:&I>&I'&I!&E:&E>&E'&E!&C,&AE&AA&A:&A?&A>&A'&A!&?I&34&12&14&>>&-o&1S&',&.M&PI&My&''&3S&2S&+-&DG&'m&Rg&--&NO&<<&-a&Co&':&SE&BB&Ye&Cu&Pd&Ct&!I&NS&'?&!)&!!&(!&'!_&'>&)>&//&<(W&At:9876543210+&&%&DO&Nb;@ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ D   9 :  ! "    & 0 AR1BSACPMOCSTCISCGCSSEGSGMWCCTSP2P1DCS3S2RIPUPDVSHJHSESSANLINNHBHHOPAECSYNKD4D3D2D1EQNUISXXOKMXMbMlFm0U0u>H<*?2InAN00RT*--+-2+Z*PNB/0dP==<>-!1000r500r100r50rcrbrar9r8r7r6r5r4r3r2r1r1000R500R100R50RcRbRaR9R8R7R6R5R4R3R2R1R785838185616453525152313AOOmTMSMN0)s(s=s-s+s9s8s7s6s5s4s3s2s1s0snS)S(S=S-S+S9S8S7S6S5S4S0S/f!*2>1<13"2"1"3'2'1'%0Sb9":9"9"69'.9'9'6!2-3-M-N-11H1TRLLR6M4M3M1M1NA+%'y=='scs%c%c=h=f=u=t=s=r=p=o=n=m=l=k=j=i=z=z%e=d=g=v=b=a=JAJUJE%"Y=="ScS%C%C=H=F=U=T=S=R=P=O=N=M=L=K=J=I=Z=Z%E=D=G=V=B=A=b3o%j*w*q*x*f*u*t*s*r*p*o*c*n*m*l*k*i*h*y*z*e*d*g*b*a*i%e%a%J*Q*X*F*U*T*S*R*P*O*C*N*M*L*K*I*H*Y*Z*E*D*G*B*A*O%I%E%A%,G'G1?1>edg'G'j<o;O;k<K<g<G<u<U<o<O<i<I<a<A<f2z<Z<Z.z'Z'Y:y>Y>w>W>u;U;u0U0u(U(U-u?U?t<T<t,T,s<S<s,S,s>S>s'S'r<R<r,R,r'R'o(O(O-ngn<N<n,N,n'N'l<L<l,L,l'L'k,K,j>J>i.i;I;i(I(i-I-i?I?h/h>H>g,G,g.G.g(G(g>G>e<E<e;E;e.E.e(E(e-E-d<D<c<C<c.C.c>C>c'C'a;A;a(A(a-A-y:u:u>u!o:o?o>o!n?i:i>i!e:e>e!a:a?a>a!U:U>U'U!*XO:O?O>O!N?I:I>I!E:E>E!A:A?A>A!?I3412141S',.MPIMy3S2SDG'mRgNO':SEBBYePdCt!INS'?!)(!'!'>)>//<(At&DONbSP@| h()iY~A(~~^Z @ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~ !"#$%&'()*+,-./0123456789:;<=>?%%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%@ABCDEFGHIJKLMNOQTVW"!% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~%%% %%%%%$%,%4%<%%%%%%%%# %"""H"d"e#!%P%Q%RQT%TVW%W%X%Y%Z%[%]%^%_%`%a%c%f%g%h%i%j%lN01F45D3E89:;<=>?O@ABC62LK7HMIGJ.&$%/ !"#,+(-)'*NVH00$. r &@@*A@2$p,Jf,$HJgHxa>XO%,`$A~ 2,%,$@JgH$<ABSHQBBSdBBB6/aPO b 2bTKR oL N^NuNV/ /$.E@2J,f/a>#,@. r @@* $.$nN^NuNV".BJm @flpN^NuUC_con_set_trans: Invalid charset handle %d. NVH08$n$. / aXOJfJA gr/ Hza/aG`\ v " 灒E" ҁAApl&p (H"@@* tB2g 2TKSf`2TIRJoJg/a@Rg BaB/*B0/a #@RPOPOB// / a:&POPOlJgJgHx/aR(POrl`JfJgHx// / a&POPOlJrfNJfB/</ / a&POPOrf JfJgHx/</ / a&POPOJm / aG``RJgLrfFJfB/<a&POrfJfJgHx/<a&rl B+p` `pL B`PJmlA@["0m^ $0l 0 m,$9@Blp`z` 瀐&BG ЀAApl*0,0 瀐&AG ЀEAplJfp`(2*lB/aN(2|PO 瀐&BG 2 Jf*@NgHx/a<&POn l`Jg/aXO/ah#@*> BB40 XOJfB/a2&POlV~fNJfJgHx/a&PO~f2JfB/<a&PO~fJfJgHx/<a& LN^NuNV//". . @zfB` _bB`~JmJ b A@[vgB`\ A@["0m 瀐"AC ЀAAplJfp`, 0*l Hx/aPO/aF#@*B00 $.&.N^NuNVH?8*. ,.. tBf `Jm. E@[ rJm 瀐G Ѐ(@CAplJfp`Jm "2l 2 mtJ@Bl`p`h 瀐&AG ЀJfF 1 @Nf: 1*l Hx/aPO/ap#@*XO y@.JgB08xl ` //I/aLN^NuNVH?<&n .&..tBB~ mp`Jg f`fJm(C@["1m 瀐(AI AAplJ fp`H $qJl 1 m4$y@BJlp`$z` 瀐I Ѐ*0-p 瀐(AI IApl&4 *lJWID//a&*nPO/aL#@*BB<0 XOJg\Jf@ 瀐I IApl 4 @NgHx/ a(POn l`~Jg/aLXO//a(PO~l`F 瀐E AApE Jf@@Rg BaB/*B0/a&#@RPOPOB//. / a>$POPOlJg JgHx/aR(PO~l`JfJgHx//. / a$POPOlP~fTJfB/</. / a$POPO~f$JfJgHx/</. / a$POPOJm / aGV`\JgT~fNJfB/<a$PO~fJfJgHx/<a$~l B+p` JnB `pLG@ZJg4 A@[ 0g// aNPOJgXKRr;m@UmHz/ G +8NPOJgHz/ NPOJfE`hHz/ NPOJfE`RHz/ NPOJgHz/ NPOJfE`.Hz/ NPOJfE`Hz/ NPOJg(HxHz/ I +NPOXOJgHz/ NPOJfE`Hz/ NPOJfE`Hz/ NPOJgHz/ NPOJfE{`Hz}/ NPOJgHzv/ NPOJgHzq/ NPOJfEn`nHzk/ NPOJg8Hz|/ NPOJg*Hzu/ NPOJgHzo/ NPOJgHzi/ NPOJfEz` Hz/ NPOJg*Hz/ NPOJgHz/ NPOJgHz/ NPOJfEy`HxHzz/ NPOXOJgHxHzj/ NPOXOJfTB*AAU0g@B*0g2B*0g$$ V/Hz(E NPOJl/HzN`HxHz / arPOXOJf>B*AAU0g*B* 0gB* 0gHjHza`Rr;m A@ZJ,f 9@Ur;l"JA g//Hz*a2/aGBp`Z&"R#@UA@b!<A@Y,!@Wl<A@Z!<A@Z B<A@[r!!!! L (.*.,.&.B@fl$EApl//aǦPOJg4:R@fmrfzFJfJfv////. /aL|N^NuWestern (ISO-8859-1)Western (ISO-8859-15)iso-8859-15Western (cp850)cp850Western (windows-1252)IBM PC US codepage (cp437)DEC Multinationaldec-mcsMacintosh (8 bit)NeXT character setHP Roman8hp-roman8ChineseJapanese (EUC-JP)Japanese (Shift_JIS)KoreanTaipei (Big5)Vietnamese (VISCII)viscii7 bit approximations (US-ASCII)us-asciiTransparentEastern European (ISO-8859-2)iso-8859-2Eastern European (cp852)cp852Eastern European (windows-1250)Latin 3 (ISO-8859-3)iso-8859-3Latin 4 (ISO-8859-4)iso-8859-4Baltic Rim (cp775)cp775Baltic Rim (windows-1257)windows-1257Cyrillic (ISO-8859-5)iso-8859-5Cyrillic (cp866)cp866Cyrillic (windows-1251)windows-1251Cyrillic (KOI8-R)Arabic (ISO-8859-6)iso-8859-6Arabic (cp864)cp864Arabic (windows-1256)windows-1256Greek (ISO-8859-7)iso-8859-7Greek (cp737)cp737Greek2 (cp869)cp869Greek (windows-1253)windows-1253Hebrew (ISO-8859-8)iso-8859-8Hebrew (cp862)cp862Hebrew (windows-1255)windows-1255Turkish (ISO-8859-9)iso-8859-9ISO-8859-10iso-8859-10UNICODE (UTF-8)RFC 1345 w/o Intromnemonic+ascii+0RFC 1345 MnemonicmnemonicUkrainian Cyrillic (cp866u)cp866uUkrainian Cyrillic (KOI8-U)koi8-uNV/ / aaHx3HxHxUO/:p/:hA`/?(HxHzHzHz Hy7EN,BHxHxUO/:/:A/?(HxHzHzHzHz N,.RHxHxUO/9/9A/?(HxHyHyHzHzN,.HxHxUO/9/9A/?(HxHyHyHzHzN,.HxHxUO/9/9A/?(HxHyHyHztHy"N,BHxHxUO/9n/9jAf/?(HxHyHyHzKHzYN,BHxHxUO/:./:&A/?(HxHzHHzDHz-HzN,BHxHxUO/:J/:BA:/?(HxHznHzjHzHzN,BHxHxUO/:/:A/?(HxHz8HyrHzHzN,BHxHxHxHzHzGNBHxHxHxHzHzuN,BHxHxHxHzHzsNBHxHxHxHzHzqN,BHxHxHxHzHzNBHxHxUO/:/:A/?(HxHzHzHz|HzNDBBHxUO/9/9A/?(HxEHyHyHzWHzsN,BHxHxBHzfHyNHxHxHxUO/:/:A/?(HxHzHzHz:HzTND.THxHxUO/9/9A/?(HxHyHyHzHz2N,.HxHxUO/9B/9>A:/?(HxHyBHyBHzHz N,.HxHxUO/:/:A/?(HxHzHzHzHzN,.HxHxUO/:/:A/?(HxHzHHzDHzHzN,.HxHxUO/9/9A/?(HxHyHyHzHzN,.HxHxUO/9/9A/?(HxHyHyHzkHzN,.HxHxUO/:/:A/?(HxHzHz HzVHzhN,.bHxHxUO/9 /9A/?(HxHy@Hy@Hz1Hz>N,.HxHxUO/9 /9A/?(HxHyFHyFHzHzN,.nHxHxUO/:/:A/?(HxHzHzHzHz*N,.AHxHxUO/:/:A/?(HxHzHzHzHzN,.`HxHxUO/90$.". gJmJm 9@zf /aI`g&G@[|8f /aDI`*(3X$38Hz /EG!NPOJgdHz /NPOJgVHz^/NPOJgH|Xf@8gB`8HzG/NPOJgHz@/NPOJfHz+/NPOJg Hz$/NJfpL |N^NuNVH<0*.(. gJm$G@[J(g&3(Hzj/EG!NPOJgHz/NPOJgJm@zf3(fz$E@[Hz$/2(aGPOJg\r(gX@zf 2f@ A@[rf2 9@g*rf$Hz=/EG!NPOJg Hz0/NJfp`BL <&n(. (n*.*nJA g4/-EJN//-/,N./,Hza/aGB+ BHz/,EG!NPOJgHz/-NPOJf<gJB+B+B+||B+|"-|WD@ Bgf<@ `$B|f J@g<@|WD@WD@J+gB+B+|B+B+ B+ `B@zgJ+fpg<BJf/a6XOJg<BBJg |f<@ |WD@ B+BJfJ+g<SD@BJf J,m<@BJ+ff J+ f<@BJg +f/aJg<B L<|N^NuNV nBB(B(B(B(B(B(B(B(B( B( B( N^NuNVH0 ."n $n".$.vn"A@[vf"fv|"$f v-$`"$L N^NuNVH0 &.$n $.rl n I/` n r I//N` n$ rI//Nr//N` n@ rr//Nr//Nr//Nr//N `X oB`^ rr//Nr//Nr//Nr//N r//N?r//NpL N^NuNV/". n JfB` S cBB` n `n n t `P n t`2 n t` t?Bp$.N^NuNVH00&nB SmI`g6I  f4|`X  f4|`B  f4|`,  f4|`  f4| SBoRH fRn SCve0;N 8\v(v?`v(v?ƒ(`v(v?ƒ(ƒ(`hv(v?ƒ(ƒ(ƒ(`:p`Bv@(v?ƒ(ƒ(ƒ(ƒ(ƒ$& L N^NuUCChangeTerminalCodepage: Called, but not implemented!NVJA gHza/aGN^NuNV n"HJgRIJf` g  b BSIc`RH g c N^NulynxcginntpsnewsnewsdataNVH8".$n BBBB BB"A IJg8 :gt /g #g ;g ?gRHJf IJg #g>RHJf /fd )/fTI%LBHx//*GG!NPOJgB%H`@I%LB`B$"H`Hx?/*NPOJgB%H`RI%I` BJg" %A gtJgnJfHz/aPOJf<*.$. &.BBBJA g4/Hz$GN/EG NPOXOJA g/HzN/NPOXOp`g|`f|g|Ɔ/EG!N&@/NHs HxaȤ(HPOPOJfHzHzaPO/HnE ,pN/HnNHn/.E"NHn/.N .gNJgHJfBJf nJgJf`0Jg*gHz/ aGPO .f .// aGPOJA g/ Hzav/aGPOXO .g/aBXO .g/aBXO/ HnazPOJg/ a n L<|N^Nu/..//..?.././NVH<(nJgg,g ?g ?g ,?gHx// aG8POJgGJgKG! ?g /f +.f +.f+ /g ?gJflEb /gSJc /fHxHz4/ NPOXOJgHxHz#/ NPOXOJgpAd /gbA&JJgJfBG`J +.fB+ /f$KAJg Jf` ?fEAJgJfBSK`JfB+RKJf Ab ?f +.f+ /fE KJfB` .fAb +/f~ +/f dr +:gjEd /g SJe /fd */f Rd<(n*. $L&LJgJg|Jgx"EJgrB(<AUK %fX*gR*gL"CJ1HlB"@J1Hl4I/N*I/NPOgI//aGrPOJgVJ`JfB L L<|N^Nu""HTMake822WordNVH00&n SJgJfHz/ a`BEB _b 2(g>Jf2| b0  g*  g  fTI` c B2gRIRHJfJgHqHxaL&POfHzIHza4PO"C" SJgNBE  g  c b2(g  g  f ( g RHJf"B g /aB&L N^NuNVJ@f a#@/./9@aJpN^NuNV/ Hy@ENHy@NHy@NHyAPNHyAhNHyA\NHy@NHyA xN.A NHyA NHyA NHyA NHyA NHyA NHyA6NHyABN.AvNa2z$nN^Nuno_proxy*filelocalhosthttphttpsftpgophercsonewsnntpnewspostnewsreplysnewssnewspostsnewsreplywaisfingertelnettn3270rloginNVH8<&.HzdaG睊(HBXOJgHzY/ aG"POJfp`JgHxHz9/Eq~N*HPOXOJgJgHx@/ aGPO ( Jg(RHxHz/N&HPOXOJgT/ HzEG!NPOJf2Hz/NPOJgaR//NPOJf/ E 5N.N`\Jg / aPXOJgBHx:/aGzPOJgB/aG$`bHxHzi/a&HPOXOJgHHza/ EG!NPOJftP` HzL/ NPOJf $<`Hz:/ NPOJft`Hz*/ NPOJftF`Hz/ NPOJfti`Hz / NPOJg*Hz/ NPOJgHz/ NPOJgHz/ NPOJftw`Hz/ NPOJgHz/ NPOJgHz/ NPOJf$<3`ZHz/ NPOJft-F`FHz/ NPOJftO`4Hz/ NPOJgHz/ NPOJft`Hz/ NPOJf$<Jg / aXOJftP/aG&XOJgBJg  c ,fRLJf$L` ,g :f&JRJJg  bJgHkaG" XO`" Jgf4Jo0m,// Ѓ/aTPOXOJfJg"/ a`Jg IJf^Jg/ aBL<N^Nu?0,0HTAccess: Appending '?0,0' coordinate pair. Proxied=NoProxy=file:news://:119/NNTPSERVERwais://:210/WWW_%s_GATEWAYftp_proxy%s_proxyGateway found: %s proxy server found: %s http:NVH0<(n*n BBBB9@/ a-HXOf %d NVH0 $.gHx/ah&POmHx/av$HPOJgpJgj#@ @@B@ @r@f/9@`/*Hy@ @aPO#@ 9@rgJA g//Hz8ab/aG*#@r`r#@ 9@g/aB@L N^NuLYUCPopAssumed: UCLYhndl_for_unspec changed %d -> %d NV/ 9@ml"9@rg"JA g//Hzaa~/aG璎POPO#@@rt#@ 9@ @g/a2B@ @#@@ @B@ 9@r`p$.N^Nushow alert:Access forbidden by ruleNVH 8&n(n $./ / a$@POmfHzazHzHx/aF`TgJJmF/ E ZN// a{/ a&H|V//./ / N. kN$@B,V a LN^NuNV/$./aXOJg / hN` $.N^NuHTAccess: loading document %s Redirection limit of 10 URL's reached.LYNXIMGMAP:Document with POST content not found in cache. Resubmit?Location=HTAccess: '%s' is a redirection URL. HTAccess: Redirecting to '%s' HTAccess: Document already in memory. www/diredHTAccess: Auto-reloading document. HTAccess: status=%d FAILGETlocal%24.24s %s %s %s Log: %24.24s %s %s %s HTAccess: `%s' has been accessed. Loading incomplete.HTAccess: `%s' has been accessed, partial content. HTAccess: `%s' has been accessed, No data left. HTAccess: `%s' has been accessed, No data loaded. HTAccess: `%s' has been accessed, transfer interrupted. **** HTAccess: socket or file number returned by obsolete load routine! **** HTAccess: Internal software error. Please mail lynx-dev@sig.net! **** HTAccess: Status returned was: %d Can't Access `'HTAccess: Can't access `%s' Unable to access document.NVH><&.(n ,.(9@ JA g/HzNa\x/aG獈POXO 9@g/a>B@XOB9@r @lB@Hz)a`J9@ gNJ9@ fFJ gHJ,Yf:/ avXOJf,Hx Hz/aG POXOJgHz aXO fJ f/ av -@XOgHx Hz/aGPOXOJfJA gg/aB>XO//./ /a$POPOJA g/HzaY/aGPOXOJ@gE/ aG狺/ <Jl </ 9@f <// G bN.Hz/9@KG N/9@aG: JA g/aGN` f"JA g/Hz7aW/aG$`Jo:HzVHyAxEG NHzHyAxN/HzHyAxNHxaߢ BHzG/ axHz/ E ,N// NHz/ N@d.anXO .g/aVBXOJA g/HzaVZ/aGjPOXOHzHx/a<8BL<|N^Nuwww/presentNV/ $n/9@ 9@fHzapXO // ax.a*./a@I$nN^NuNV//$.B/. aJ&BBBBB.B./Hna^/.aHx//aT-HHnaT .g/aFBXOJg /a4XO .g /a$BI$.&.N^NuNVH<*.BJg`/a~P&/a~tPOJfP/a~$/9@ 9@fHzanXO ///a.Jg /aXOJfB`.</a~ XOg //aa` Jf/a_:pLJ@f _bAJ08g`%/Nr‚/NPORKbBHx?/.aG焾POJgBHzG/ E ,N// NPOPOJg /azXO//.aPO .g /a\BIL<Bad File RequestAddress should begin withHelp �Document address invalid or access not authorised�HTTP: close socket %d to retry with HTTP0 �%20s %d�HTTP: Scanned %d fields from line_buffer �a� URL=%s (%s) �STATUS=%s �--- Talking HTTP0. �text/plain�HTTP: format_in being changed to text/HTML �text/html�identity�8bit�binary�7bit�HTTP: format_in is '%s', � Treating as '%s' with encoding '%s' �--- Talking HTTP1. �Got unexpected Informational Status.�Request fulfilled. Reset Content.�www/download�Got unexpected 304 Not Modified status.�Redirection of POST content requires user approval.�HTTP: Have POST content. Treating 301 (Permanent) as Temporary. �Have POST content. Treating Permanent Redirection as Temporary. �HTTP: Access authorization required. � Use the -auth=id:pw parameter. �to retry with Access Authorization�HTTP: close socket�%s %d %s �Retrying with access authorization information.�Show the 401 message body?�Can't retry with authorization! Contact the server's WebMaster.�HTTP: Proxy authorization required. � Use the -pauth=id:pw parameter. �to retry with Proxy Authorization�Retrying with proxy authorization information.�Show the 407 message body?�Can't retry with proxy authorization! Contact the server's WebMaster.�Unknown status reply from server!�HTTP: Interrupted followup read. �message/x-http-redirection�www/debug�Sorry, no known way of converting %s to %s.�HTTP: Trying again with HTTP0 request. �HTTP: Picked up location '%s' �/�HTTP: Proxy URL is '%s' ��NVT'H?<-n�zBB.yB.wBB.oB.mB.i"n� J)�Xg|�y`"n� J� g|�wJzft` "nzJft��@dHzLaT`�rHx� Hx� HzCHnaGv4|�qPOPOBB.kB9�@B9�@BHx�Hz/.zaGv4POXOJfHz`��HnHx�PHz-/.�a��l$�POPO f8J�A gHzaC/aGtPO��@dHz%aШ$<`�Jl4J�A g /9G ,/.zHzaC/aGtPOPOHz<aN`Hx�HzN/.za:$HPOXOJ.wg-|�rHz2` J.yg-|�rHz)` -|�rHz%Hna�POJ9�@gHj�`/ Hna�NPOJg / a�XOJ.qgHzG/ E� ,NHz/ NPOPOHnE/ a� POJ.qg� Hx�Hz"n� /)�av$POXOg$Hx� Hx� /Hz/ a�POPO.a�^XOJ�A faB/9�A a�|*@<�BBXOo�IG//9�A a�|$HHzDa�\>POXO�f�PHz:a�\(-RTXOTg�8Hz-"nT/)�a�}POJg�Hz R/(�a�}hPOJg�*D���\�8��]�8��8�: *�o/�'t�HzHnaGsz�`8't�HzHnaGsbPOPO` *�o/�HzHnaGsFPOXO`B./ R/(� <�Jg <�/�Hz/ a�x/.aGs0Ԁ� ���o6Jf2HnHna�~L/ R/(�Hzs/ a�:/.aGr$��/.Hna�~BPORn�Hx� Hx� <�Jg <�/�Hz0E/ G� 6NHx� Hx� Hz'Hz,Hz-/ N�, y�@ JgJgHx� Hx� /Hz%/ N� y�@ Jg��Jg��HzI/ K� ,N/9�@ E/ a�|/.GG!N n� 0�,f/N nB0XO/.avHz/.G� NPOXOJf Hz/ NPOHz/.NPOJf Hz/ NPO/./ NHx� Hx� Hz/ a��J9�@g.Hx� Hx� HzG/ E� 6NHx� Hx� Hz/ N� y�@ `Jg8Jg4/awLXOJgfHx� Hx� /9�@ `HxHzHna�,�`@Hx� Hx� /9�A 9�@ ,f <�/� 9�@ (f <�/�HzbHna�� 9�@ g$J9�@ kfHx� Hx� /�HzZHna��J9�@ #f��J9�@ if��J9�@ jf��HzlE�N/aGp~POJg��&y�@0JfN&HHz I/ K� ,NHx� Hz/ a�zP�Jf*Hx�#/ aGp,$HPOJgBHk� / NPOJg�#`/ / NPOHx� Hx� HzHna��POPOHx�Hz"n� /)�aGoPOXOJWD�@cHx�Hz/.�E�q~N-HdHx�Hz/.�N(Hx�Hzz/.�N*H�$Jg$Hx�:/ aGozPOJgB/aGn-@XXO`(Hx�HzR/.�aGonPOXOrP-AXJf-|��XJ9�@g�Hx�Hz /aGo>POXO&<��JgvPHx�Hz/E�q~N$Hx�Hz/N&H�Jg Hx�:/aGnPOJgB/aGmt&�XOB/ //a�z$HPOPOJg��JgBHx� Hx� / Hz_Hna��J�A g��/ HzHa</aGmPOXO`��Jg��Jf��J9�@ f2J9�@ .fHz3aςXOJ�g |�o`��J9�@ fJ9�@ .g Hz2aXO .g/�a�BXOJg / a�XOJg /a�XOJdg /.da�XOJg /a�XOJg� / a�`��J�A gHza;/aGlPOHx�Hz/aGmPOXOJf.cr΁/// /aV(HPOPOJg /a�BXOJg / a�4XO<�`".cr΁//.X/.d/ a(HBPOPOJg�� �$g:HzG/ E� ,NHn/ NPOPOJ�A gHzpa:/aGkPOJgDHz~G/ E� ,N/ / NHn/ N�J�A g/ HzYa:/aGkPOXOJg / a�pXOJdg /.da�^XO~΂///.X/ a�$HPOPOJg��JgPHx� Hx� / HzHna�D�J�A g��/ <�rJg <�w/�a:/aGk&POXO`��Jg��Jf��J9�@ f@J9�@ .f(HzaXOJ�g �f |�m`��|�o`zJ9�@ fJ9�@ .g HzaxXO .g/�a�zBXOJg / a�hXOJg�/a�X`�J�A g" <�Jg <�/�a9R/aGjbPOJg / a�XOJg /a�XOJ.wg��J�A g("n� )�$f <�/�Hz'a9�/aGjPOXOHx� Hx� "n� )�$f <�/�HzHna�Hx� Hx� "n� )� g /�aGjXO`B/�HzE/ a��(Hn/ G� ,N"n� /)� / NPOPO`HnHna�uPOJ�A g.A4"n� J� gA//.Hza8</aGiLPOPO��@dHza/.aGj/�/./.aGjN$�� .g/�a�}BXO .g/�a�}BXOJn��f"J�A g��Hzya7/aGhPO`�� 9G ,rMg ~Jgr fTJ.ifNJ.wfHJ�A gHzZa7v/aGhPO��@dHzuaD/.aGh B.q|�iPO`�J�A gHzda7./aGh>PO/.aGgtHza`�B`�`J�A gHza6/aGhPO��@dHzaB&<���/Hx�a�&HPOXOJfHzHzaPOBBa$PO  ���n$փ// a�~&HPOJfHz]HzdalPOJ�A g CHhHzsa6P/aGg`POXO CHhHsX�/.a��$�POXOJ�A g/HzPa6/aGg$POXOJn�� f2J�A gHz3a5/aGfPO��@dHz3a¶`�JlP 9G ,~Mg rJg~ f8J.if2J.wf,J�A gHza5/aGfPO/.aGfJXO`� J�A g/Hza5`/aGfpPOXOHz.a/.aGftPO`� *B/ a´PO ЂB3�Jg<Jg /a�zXO/a�xf,XOfHzHzaPO// /aGfPOXOHx� HsX�aGf(HPOJgg ,� f|� ڂJf�Jfrcl�(J�A g/ Hza4/aGePOXOJ.qg��Hx�Hz/ EG!NPOXOJg:Hx�Hz/ NPOXOJg&Hx� Hz/ NPOXOJgHz/ aGf*POJfjJg / a�yXOJg /a�yXOB.q|�iJ�A g/.Hza3/aGdPOXO/.aGd��@dHzaPO`�zB.HnHnHzq/ a�b&�POPOJ�A g/Hz]a3/aGdPOXO 9�@ (g>Hzi/�aGdr$POg,/.r/.zHzQ/EG N/ HzQ/N/aGd � ~l6.g0 ��Hf* .�Tf" .�Tf .�Pf .�/f .�.g�DJ�A gHza2/aGcPOBHn/.za��\*HHx� Hz/-�aGd�Jf*J�A gHza2/aGcPOHza�L*HXOJg��HzI� NXOg��HzNXOg��HzNXOg��HzNXOg~J�A g/-�Hza2*/aGc:POXO/-�"n� Hi�hE� ,pN n/(�"n� Hi�pNHz&N*H�J�A g" n/(�Hz Hzoa1/aGbPOPO&`�Hza�K*HXOJ�A gHzja1/aGbPO&<�Jg & R `BEG!/ NXO 3� f / NB3XO` .$�L<,Q~$Sre�0;*N�� ���Hza|�y`�J.yg / a`� . ���g2n ���g `H ���g$`>/ a/.aGa~#�@ `Hz`/ a/.aGaztFPO`�/ a`�J9�@ fJ.yfJ9�@ g / a``�~$n��,f/ a.XOJ9�@ f�&`�4��0fHzsa |�y`�>Ardµ��3nJ9�@ .fJ9�@ gHJ.wgBA~d8��-g0/.aG`tHzAaPOJ9�@ g�/ aXO`�/ aXO ��-f8J.wg*J�A gHz/a//aG`POHz]aXXO`��@|�k`� . ��g��n ��g`� ��g�`�J.of�NB/.//a�0POPOJ�gp/.aG_XOJ9�@ .g"J�@ ,fHzHy�AxEG NHz-`��J�A g"HzD/.Hz_Hzna./aG_���@dHzZ`��J9�@ f,J9�@ .fHzraXOJ�f�J9�@ f J9�@ .g�XHziaJXO`�HJ9�@g�xJ.mf�pHx�/.//a�PPOPOJ�g��/.aG_ XOJ9�@ .g2J�@ 4f*HzPHy�AxEG NHzcHy�AxNtFPOPO`�J�A g"Hzk/.HzmHz|a-/aG^���@dHzcaXOJg / a�sXOJg�j/a�sXO`�\J9�@ f(J9�@ .fHzTaXOJ�fdJ9�@ fJ9�@ .gBHzOa6XO`4/ a*/.aG^ tF`�THznE��y~N/ NPOJ9�@ g/.aG]tXO`�J9�@ .f Hz4E� NXO�f HzN-H�XOa9 JgL/.aG]XOJ.kg0J�A gHza,/aG]PO��@dHzaXO$<`�J.yfJ9�@ g&*Hza�F*H`pJ.kglHzE� N*H/-�"n� Hi�ha�iPOXOJ9�@ gHzN-H�XOJ�f.a�-H�`"J9�@ .fHzFNXO�f Hz&N-H�XO/.� /.�/.�/ a�$HPOPOJfXB~/.aG\"n�/)�/-�HzcHn~a�s ��@d/.~a� .~g�/�a�qB~XO`� R/// h�N/ B//./.� a�&$��~f&$<J.kg J9�@ gt/.aG\XO`�4rf�� RB/ h�NPOJ.kg J�@f��/.aG[XOJ.kffJ.if`J.wfZJ�A gHza*/aG[POJg / a�pXOJg /a�pXOB.q|�i��@dHzaXO`�`$<`� g~g R/ h�N` /.aG[FXOJ.kg�Z 9�@g�@J�A g/�Hz;a*N/aG[^POXO f: 9�@g/�a�p B�@XOJ�A g� Hz`a*/aG[PO`��/ aXO ��1fh/9�@aG[ y�@XO 0�/gHzHy�@a�gPO"n� /)�Hy�@a�fPOJ�A g/9�@Hza)/aGZPOXOJ.wgR$nArdD/ /9�@aƶPOJg ��/g(` 9�@g/�a�o$B�@XOtF`$��@$<��`t7FJ9�@ gt`t7FJg / a�nXOJg/a�nB9�@ L< . HN^Nu/Net/�/tmp/W3_Cache_�*�*.*�%%%.*ss��NV�H�8(n� n� &n�Jg$/HxHzE�/ aGZp/ / / a�o` TJg JgJfB`Jg / / a�e T L�N^Nu%%%.*sd�%d��NV�H 0&n� n� $.�Jg$/HxHzE�/ aGY// / a�oP`/HzE�/ aGY/ / a�d S L N^Nurwx�rw-�r-x�r--�-wx�-w-�--x�---�rws�rwS�r-s�r-S�-ws�-wS�--s�--S�rwt�rwT�r-t�r-T�-wt�-wT�--t�--T� %a� -> �Directory��application�x-�%.12s�%.7s %.4s �K�%c%s%s%s�%�Unknown format character `%c' in list format �NVH?<$.�,.� *n�BBHn/aGZPOJl$<�4/Hna�c&n/ aGXЮ-@ UBHxBBHx�V/ h�N�$Jg�*B& Jg �%f +�%�fRKRKJfBd U// h�NPOg�dRK& A�AU`RKI0��f� ��c � g �#g �+g �'gBI~te�0; N����\~F0 U// h�NPO`� /.�/.�/ a�/.�/Hna�, U/./ h�N� UBB/ h�N nBPOXO �Ag�0.@� @�f�Hx�//aGX($�POXOm�~ UHz/ h�NA(�B( U// h�NPOPO`�T0.@� @@�f* �TgHz/Hna�`�*Hz/Hna�t`�HnB/a� $HPOXO �Tg^JfFHx� Hz/*�IG!NPOXOJf$p Ъ�-@Hx�Hz/�NPOXOJf T`-j�/./Hna�`�/*�/Hna�`�BaGU$�Hna�@PO �nHh�Hz HnaGUPPOXO`Hh�Hh�Hz HnaGU4POPOHn/Hna�`�*/./Hna�`�0.@� @@�fHz/Hna�T`�". ��j ��~ /�/E/ a�Hz/ a�`�`�0.@�8� ��`�gVn �� �g:n ���g*`R ��@�g,`H ���g4n ���g`4 ���g&`*<�p`(<�c`"<�d`<�-`<�b`<�l` <�s`<�?0.�� g ~A�@d` ~A�@ 0 �/�0.�� g A�@@` A�@ 0 �/�0.�� g A�@@` A�@ 0 �/�~΁/Hz/aGS//Hna��$`��B0./�a�XOJg//Hna�`��B0./�/Hna�>`lB0./�a� XOJg//Hna�`JB0./�/Hna�`62n/ /Hna�`$Hz/Hna�p`I/HzHy�AxaGR*POXO .g U/�/ h�NPORKJf�h .g/�a�fBXO UBHx�V/ h�N UHx� / h� N� .g /�a�fBL<N^Nuidentity�8bit�binary�7bit�HTSetSuffix�../../../WWW/Library/Implementation/HTFile.c��NV��H<<(.�*.� *n�BJgBJg>Hz/ EG!NPOJg*Hz/ NPOJgHzx/ NPOJgHzq/ NPOJf<�Hz!/EG!NPOJf E�@`�NHz/NPOJf E�@`�6(y�@& G� Jg (l�Jg$TJg�� g//�"CNPOJfJgDJ�g��HzNXO�g��HzNXO�gzHzNXO�glHzNXO�g^`J�gHzNXO�g�|HzNXO�g�lHz~NXO�g�\HzuN"*�XOg�J"A/)�/ "CNPOJf�6JfVHx�Hx�a�i$HPOJfHz:HzBaPOJ�@f a�T#�@/ /9�@a�VL// a�[HPOPOJg/a�8%H�XO/ a�8z%H�/.�Hj� a�[.T��*d��L<<N^Nu%s/WWW/%s/%s%s��NVH8 $.�Hx�Hz/E�q~N&Hx�Hz/N(Hx�Hz/N$B� .///9�@HzHna�e�Jg /a�cXOJg /a�cXOJg/a�c n LN^Nu/�URLPath `%s' means path `%s' �NV//&.�.�BB/Hna�ZPOJg/.aXO`Hz/.a2POJ�A g/./Hza/aGN&POPO/.Hna�YPO .g /�a�bB n $.&.N^Nufile�localhost�Node `%s' means path `%s' �%s%s%s�Node `%s' means file `%s' �HOME�/tmp�HTnameOfFile_WWW(%s,%d,%d) = %s ��NVH8<&.�.�.�Hx�Hz/E�q~N*HHx�Hz/N&HHx�Hz/N$HB�$Jg / a|XO`Hzj/ aPOHz/ aGMPOJgJf��a��// I� +8NPOJgHz/ NPOJgJf&J�A g��/ /Hza/aGLPOPO`zJgv/ / HzHzHna�b�J�A gb/./HzaV/aGLfPOPO`DJg2HzaGL XOf <�-/ / / /�HzHna�b^�`/ Hna�WPOJg / a�`XOJg / a�`XOJg / a�`XOJ�A g /.I/I//HzBa/aGK n L<N^Nufile://%s�file://%s%s�File `%s' means node `%s' �NV/ $n�BHx�/ /9�@aGLdPOXOJfHj�HzHna�a|POXO`/ a��/HzHna�a^POPOJ�A g/./ Hzxa/aGK n $nN^NuNV��H<8*.�(n� BJgBJg>Hz*/ EG!NPOJg*Hz/ NPOJgHz/ NPOJgHz/ NPOJf<�/9�@a�S&�BXOo��G� //9�@a�T$HPO�f��JgBJ�g��HzNXO�g~HzNXO�gpHzNXO�gbHzNXO�gT`VJ�gPHzdNXO�gBHz_NXO�g4HzVNXO�g&HzON"j�XOg/)�/ aGJPOJf R` Rn�DAD L<N^Nutext/html�application/octet-stream��NV��H?<..�&n� *n�JgBJgBJ9�@ g JgHza�2V&XOHza�2H`�/aGJ2(�/9�@a�R~,�BPOo�ZI� //9�@a�R$H/aGI&�POXOm�( Є/�/a�S`POJf�Jg&�Jg*� *�f�^Bo��//9�@a�RH$H/aGI"� ЁPOXOm��/ Є/�/a�SxPOXOJf��J�g��JgJf*� Jg��Jg0HzNXOg$HzNXOgHzNXOg HzNXOfLHzNXOg@J�g:HzfNXO�g,HzaNXO�gHzXNXO�gHzQN *�g& j�`pRn�Rn�Hx�./aGHPOJgA�@ E�@Jg E`E�@JgJf *�fHza�0XO & *�f Hza�0n  @ L<N^Nucharset�HTCharsetFormat: Extended MIME Content-Type is %s �x-transparent�iso-8859-�windows-�cp12�cp-12�ISO-8859�NVH?<,.�*.� BBB"E )�0g/�a�["EB�0XO"F/)�Hna�R\/.aLHx�;/.aGGx&H�Jg�tHz(/ a�$HPOJg�JJ�A g"F/)�Hz aH/aGFXPOXO^J`RJ �� g ��=g/ Hna�Q$nPO` � cRJg �"g � ��bB$n/ ao$�/9�@U/I�ejNPOXOJ�g6<�B/.a�.,/ "EHi�0a�QpHx�B//a�F�`:Jl6$9�@vl$9�@r/9�@U/NPOJ�g<�Hx�B//a�F~POPOJg��B/I� N&HHx�Hx�/9�@U/K� !N$H�Jf Hx�/N$HPOHz /+�IG!NPOJf&��@Hx�BHx�/a�EXO./NPOPOHz/*�NPOJf&��@Hx�Hx�B/a�EXO./NPOPOx�g&B�@+���f�h�@Uf�^��@`�Rx�f�H/*�/+�aPO`�4BHx� HzS/ aGE`POXOJfB*� A�AU0��g<�B:DJfBHx�Hz%/ IG!NPOXOJg(Hx�Hz/ NPOXOJgHx�Hz/ NPOXOJf<�:DB8 Jg<Hz 9�@UK�@Z/5 �I� NPOJfHz 9�@U/5 �NPOJg<�JgB/.a�,,XOJg"G� JgBA�AU0��gRKJfBJg/ "EHi�0a�O��@PO Jf"E )�0/�aXO .g"/�a�X�B`JgB/.a�,,XO .g/�a�WBXOJf$"EJ�0fJ�mHx�B/.�/a�CPOPOHxBHx�/a�D F L<N^Nudisplay character set�n�GetFileInfo: '%s' is a%s %s %s file, charset=%s (%d). ��NVH?<*.�(n� *n�,.�$.�..�BBHx�/a(/Hnam/.a�5:/a�:@&H&+�0/Hn/a�z� .�@j/ /a�$HB/ a�B$��JfJmA�@[&0`&<� J�A gh///*� n <�JJg (�/�Jf j� <�J �af <� ` h� <� �8g <�J/�/HzaN/aGA^� Jg /a�VXO .g /�a�VBJg(Jg*Jg"F"Jg"G"J� g"n� "L<N^NuFile: Value of %s is %.3f ��NV��H< *.�/aGA&�/9�@a�J(�BPOol//9�@a�J@$H/aGA"�POXOmD Ѓ/�/aGApPOJf.J�A g*D�'t/HzjaP/aG@`*D��`Rn<D�>L<N^NuFile mode is 0%o, uid=%d, gid=%d. My uid=%d, %d groups (� %d�) � File is not editable. �NVH8�Hn/.�aG@POJf��HnHx�aGA&�aGA(�POJ�A gl//B0./�B0./�B0./�HzJaj/aG?zB�o /6,HzcaJ/aG?ZPOXORnHzKa./aG?>PO0.��fJ�lB0.fp`>.�gBo4.B2 gRnJ�A gHza /aG>BL�N^Nuwb��NV��/.�a�76Hx�Hx�/a�DHz/aG> �g /�aX` N^Nu../�..��NVH 0$.�&n� $n�BBHz/ aG?FPOJfHzHna�IPO`lHx�/ a-H/aG?"$@POXOrlH n 0�%f< 0�2f4B0A�AU0��g/�a�a*XOrFg`rFf nB0JgJf" n <�Jg /�B/a� �POXO`TB/. n <�JJg <�/�/ HzHna�S/.B/a� � .g/�a�R0BXO .g /�a�RBL N^Nu/~�type=�/%2F�/vmsysu:�/anonymou.�Welcome� directory�Current directory is �vmsysu:�anonymou.�/..�%2F�%s/..�/../..�.�Up to ��NVH8<&n�.�/.� a�5&Hx�Hz&/aT(HBBPOPOJg8Hx�HzB/ aG=xPOXOJf J,�fB,�`B�RJ4fB4�Hx�;/ aG=P-HPOg��Hx�HzHh�a�GPOXOJf�� nB(�A�AU0��g /�a�_6XOrDgX nB(�A�AU0��g /�a�_XOrAg0 nB(�A�AU0��g/�a�^XOrIg` rIf nBBHx�// aG<$BHx�Hx�HzA/ E� +NPOXO LJfA�/a�-HHx�Hz/N�JgHx� Hz/.NPOXOJf6"nRI/ HnE� ,pN/.HnNPOPO .g/�a�OBXO SBHxBBHx�5/ h�N SHx� / h� N� SBHxBBHx�n/ h�N$S� n <�Jg /�/ j�N SHzx/ h�N SBHx�n/ h�N SHx� / h� N�$ SBHx�5/ h�N SHx� / h� N SBHxBBHx�0/ h�N�,$S n <�JJg <�/�/ j�N$SPO n <�Jg /�/ j�N SBHx�0/ h�N SHx� / h� NHx�Hz/.a�D�(Jf(Hx�./.EG!N -@POgHx�//�NPOJg.Hx� Hz/.a�DjPOXOJf.Hx�//.aG:DPOJf .g�/�a�NBXO`� .g/�a�NBXOJg�r"BJ)�g�hBRBHx�// aG:*HPOJg.Hz/ aG9POJg�8Hx�Hz/ a�CPOXOJg�Hx�Hz/a�CPOXOJg�B/HzHna�N/aPOPOJ�g��B <�Jg /�E/ a�D$Hz/GG!NPOPOJfHz`Hz/NPOJfHzg/ a�DpPO/.a/.aG<N POf: .g/�a�LBXOJg /a�LXO .g�R/�a�LB`�@/�aG< XO .g/�a�LBXOJg /a�LXOJg / a�LXO .g /�a�LpBp`��/.Hz/ a�POXO .g/�a�LDBXO SHz/ h�NPOJgtHz/EG!NPOJgHz/NPOJf SHz/ h�`PBHm�Hna�B/.ar S/./ h�N� .g /�a�KBXO` SHx�// h� NPO SBB/ h�N SHx� / h� N�Jg /a�KzXOJg/ a�KlBL<N^NuREADME�%s/%s�r��NV/ /$n�BHz/.� HzHna�LHz/.aG6@$�g�� R-X-X-X-X-X-X-X-X-P RBHxBBHx�V/ h�N�/aG5XOrg RI/�/ h� NPO` RBHx�V/ h�Na�n"/aG5POPO .g /�a�J~B$.$nN^Nuprint_local_dir() started �/foo/..�lynxcgi:�www/dired�Reading directory...� %s/�A%s�D%s� %s�C%s�F%s�OK�Reading the directory interrupted by user �D..�A..�Subdirectories:�Files:�Data transfer interrupted.�Empty Directory�NVpH?<..� $n�BBJ�A gHza/aG4PO/ a�,-HxHx�Hz/.xa.$Hz/aG5L�JfHz`$Hx�//aG5VPOJfHz` |1F`�Hh�Hna�?POJg /a�HXO 9�@jmHx�Hx�/�/ a�5POPO/.�/.�/ a(H T-X-X-X-X-X-X-X-X-PBPOXOzWD�RzlB/ / a�@wHx�Hz/*�aG4�Jg Hz a�t// a�,,��@ POXOz�@f // a�POHyG!a��-HrB��@dHza|7FPOKG!x؎/.�aG7>&HXOJg�NB|JgHz,E�/ NPOJgHz^/ NPOJfJ.wgHzJ/ NPOJg �.fJ9�@ ~fJ9�@ g//a�>VHz/NPOPOJgHz/a�>PO$ P//a�>Hn/.aG3D0.@�POPO @@�f0z�@ f/Hz`FHz/NPOJf/Hz`0/Hz`( 9�@ zf/Hz`zf/Hz`/HzHn|a�H,PO.|/.ra��x 9�@ POo"L@�` "Ly��CGNJf a Jf�R`� ���g2��@dHzjatXO`8��@dHza^|1FXO`�J�A gHz;a�X/aG1hPOB/.ra��$HB<�IPOJg�K(<G!// a�<Hz/"DNPOPOJg / a_XO&RRK/ / a�=8/.afHz/"DN�Jg��Hz/"DNPOJg�� R<�F �Df<�Dg��<�F �Df<�D TBHxBBHx�0/ h�N�z�@ gN TBHxBBHx�&/ h�N T� <� �Df <�/�/ h�N TBHx�&/ h�N� TBHx�0/ h�N THx� / h� N�/./ / /./9�@ a�/ /.ra��$H 9�@ �o"L@�` "Ly��CGNJfa�h(a Jf�,RJf� ���f0 �If* TBHxBBHx�S/ h�N THz/ h�N� /.�aG3XOJxg /.xa�D6XO .g/�a�D&BXO .g/�a�DBXO/.ra�� XO ���f"z�@f // a�PO T/ h�NXO` B/ nNPOa�g L<HN^Nuftp�.multi�Multiformat: directory scan failed.�application/x-compressed�www/compressed�gz�application/x-gzip�HTLoadFile: value of presenting %s is %f �Could not find suitable representation for transmission.�HTLoadFile: can't stat %s �%s is a directory �Directory browsing is not allowed.�.www_browsable�Selective access is not enabled for this directory�Opening directory %s �This directory is not readable.�HTLoadFile: Opening `%s' gives %p �PUT�x-compress�x-gzip�file://localhost�Can't open `%s', errno=%d �Can't access requested file.��NV\' H?<BB/.�Hna�8ZHx�Hz*/.E�q~N&Hx�Hz/.N*�.���Hz/.N$/HzEG!N�Jg /HzqNPOJgVa��r//NPOJgD .g/�a�@BXOJg /a�@XOJg /a�@XOJg�/a�@XO`� .g/�a�@BXOJg /a�@XO"n� )�hg$J�pg/�E� N&H"n� /)�pN-HPO`8$9�@jJ9�@Ug B9�@U$9�CH.BHn/a�//.� /a�&H�Jg /a�@0XOJ9�@f�Hx�Hx�/.�a�-H/EG!NPOPOrd�`HzD/.NXO nHhaG+POJf�<<ExB`B\BHx�//.aG+*HPOJg&g B/ N.�]B5x�/.aG.-HdPOf. .g/�a�?xBXOJg /a�?fXOHzHx`�,<� X�]/.daG.(HXOJg�,JgG�/ aG+PXOl// / aG+JPOXOJfBHn/ a�(/ a�Jd�B//.�/"FNd�D�� �8bB/ aG*$@BXOrlt 2�Zfl 2�.fd/ Hna�5 nB0BB/.a�2&H� .g/�a�>xBXOB//.�/ "FNd�D�POPO�8�Hz`��rl��HzHta�3POJf�� 2�.f��Hl�Hna�4 nB0BB/.a�ߤ&H� .g/�a�=BXOB//.�/ "FNd�D�POPO�8�"Hzba�B//.�/"FNd��D��8�"Hz$a�B//.�/"FNd��D�<T8x@J�A g 't�"D/)�Hzad/aG(t�E-D`-n\EHl�Hna�3PO`�/.daG,bXOJ`g8&n`-n\|�/B/.Hna�4@PO .g:/�a�<BXO`* .g/�a�<BXOJg /a�<XOHz`�Hn/.EG!NPOrf(J�A g�/.Hza/aG'POXO`�0.@� @@�f�dJ�A g/.HzqaT/aG'dPOXO 9�@f* .g/�a�<BXOJg /a�<XOHzD`�PrfjBpHzU/.HzHnpa�=<Hnt/.pN�Jg> .g/�a�;BXOJg /a�;XO .pg/�a�;BpXOHz`�J�A g/.Hz%a/aG&POXO/.aG* XOf* .g/�a�;HBXOJg /a�;6XOHz`�/.�/.�/.� /./�a�$�� .g/�a�;BXOJg�/a�:`� @�f . n"n� #@�Hz{/.aG%(POJ�A g//.Hza/aG%POPOJg�DBl/.a�XOJ�g8Hza�&/.� a�$$//a�.POPOrf //a�,&POJgtHzI� NXOg`HzӵNXOgRHzӬNXOgDHzӥNXOg6/+�"n� Hi�hE� ,pN n/(�"n� Hi�pNHznN&H�`�8/.aG%$@XOrl�" n 0�Zfl 0�.fd/HnlI� ,pN nlB0BHnh/.la�(&H� .lg/�a�9nBlXO/9�@j/.� / a�ݜ/(�"n� Hi�hNHzP`��rl��Hz nHpa�.POJf�� n 0�.fz/HnlI� ,pN nlB0BHnh/.la�ږ&H� .lg/�a�8BlXO/9�@j/.� / a� /(�"n� Hi�hNHz"n� Hi�pNHz8a� &H� .g/�a�8BXOJg /a�8zXO/.�//.� /.�/ a�a$�/aG#X `�� .g/�a�8DBXOa��j//aG$HPOJgDJg /a�8XOHx�Hz./.�aG$:POXOJfp``/.�/.�/.� /.�a��H`HJg /a�7XOJ�A g /9G ,/.�Hza/aG"POPOHzHx/.�a״L<.0DN^NuHTBTree_new�../../../WWW/Library/Implementation/HTBTree.c�NV��/ Hx�a�4$HXOJfHzHza{J$�B� J $nN^NuNV��/ $n�Jg *�g/�aXO *�g/�aXO/ a�6$nN^NuNV��/ $n�/*�aXOJg/ a�6$nN^NuNV��/ $n�Jg0 *�g/�aXO *�g/�aXO g /�a�6BXO/ a�6~$nN^NuNV��/ $n�/*�aXOJg/ a�6X$nN^NuHTBTree_add�NV��H?<(.�$n� "D )�fVHx�a�3"D#H�XOfHzHzaz("D i�B� i� i�B� i�B� i�B� i�B�`�<�*@// "D QNPOJlH -�g*@`>BHx�a�3$+H�XOfHzNHzayPO&m�'M�&B�B� B�B�// "D QNPOJmH -�g*@`>BHx�a�2+H�XOfHzHzayXPO&m�'M�&B�B� B�B�Jf�L$M(K�f$*� ,�",� o R%@� `$*� ,�",� o R%@�(J$j�gJf<�B|m� -� �jD|m -�g�*@`�pRJ�f m�J�f h�J�fJ�fvJ�f m�J�f h�J�fJ�fv"m� �o�&m�+k�� m� -� o @RH'H� -�g��$@(K<�.,��f<$*� Jg l� ,�o @RH%H� B`"G i� )�o @RH%H� *� `:$*�Jg l� ,�o @RH%H�B`"G i� )�o @RH%H� *�(l�$j�gJf�p$m��f%K�+k��'M��f%K�+k��'M�'J�`B�+k��'M�+K� m�`� &m�+k� � m� -� o @RH'H� -�g��$@(K<�.,��f<$*� Jg l� ,�o @RH%H� B`"G i� )�o @RH%H� *� `:$*�Jg l� ,�o @RH%H�B`"G i� )�o @RH%H� *�$j�(l�gJf�p$m��f%K�+k��'M��f%K�+k��'M�'J�`B�+k��'M�+K� m�Jg!M�Jf�f`*m�J�f"D#M�L<N^NuNV�� n� .� f h�Jg@J�g: h�J�f`. @ (�g @J�g h�J�f`�f I"h�Jf I N^NuHTVMSname�../../../WWW/Library/Implementation/HTFTP.c��localhost�::�%s%s�%s%s:%s�%s%s:[%s]%s��NVH<<*.�&.� /GG!NR/�E� 3 N(/NV/�N*Ha��b$POPOJgJfHzXHz^auPO//aGtHx� Hzm/aG�Jg��&B$Eg�� ��.g��Jg��BI�AU �.g���4�8�g/a�?XO$�`B�B4��g/�a�>XOf`4g0// aGHx�./ aGpPOPOJgBHz/ aGTPO`RKRJg ��.gJf�zHx�/(DRL/ $<G!"BN$HHx�//aGJ&HPOPOJf/ / HzHy�Aa�1RPOPO`��f$ JB// / HzkHy�Aa�1,�/�`^-J"nRB KB//./ / Hz=Hy�Aa�0�/�/Hx�[/9�A"BN� �]g �/f�.RH �]fJg / a�/TXOJg/a�/F y�A L<<N^NuNV��/$9�A(�A,eDHx�Hy�A(/9�@a��f"� ft#�@Jnp`$ <�A(Ҁ#�A,#�A( y�A(BR�A($.N^NuHTFTP: Closing control socket %d �HTFTP:close_connection: %s��NV��/ /$n�J�A g/*�Hza/aGPOXO/*�aG<$�XOJ�A g$Jg /9G ,a�5/HzaD/aGTr%A� 9�@f #�@ `&"@Jg Qf"�@fB�@`"HJfp$.$nN^NuNV�� 9�@g/�a�-B�@N^NuAdding message to help cache: %s �NV��/$.�J�@g/Hy�@a�$`/Hy�@a�$BPOJ�A g/Hzaj/aGz$.N^NuNV�� y�@ N^NuNV�� y�@ N^NuHTFTP: No control connection set up!! � Tx: %s�HTFTP: Error %d sending command: closing socket %d �NV��/$.�J�@f J�A gHza/aGp`��Jg|J�A g/Hza/aGPOXO/aG/�/ y�@/(�aG$�POPOl8J�A g" y�@/(�/Hz<a>/aGNPOPO/9�@a� `p$.N^NuHTFTP: Interrupted in HTGetCharacter, apparently. � Rx: %s�230-�250-�220-�%d%c�Error on rx: closing socket %d �000 *** TCP read error on response �HTFTP: They close so we close socket %d �CWD�CDUP�NVH80&.�t/a�jXOJm�,GG!E�Aa�F"� �� g �Af��J�A f��BJ�A gHy�AHz a/aGPOXOHx�HzHy�ANPOXOJg0Hx�HzHy�ANPOXOJgHx�HzHy�ANPOXOJf Hy�Aa�XOHnHnHzHy�Aa�.POPOxf .�-f��$.`��f�� .� f��t`��J�A gBJ�A gHza$/aG4PO y�@/(�aG y�@x!D� <`��xf�J�A g y�@/(�Hza/aGPOXOHx�$HzHy�AaGL`8xf�x . ��f6J�A g y�@/(�Hza~/aGPOXO/9�@a�p`X ���f:x�@f0Hx�Hz/a�HPOXOJgHz/a�Jf-|��+".$L<,�Qx衐L N^Nu%.*s%c%c��NV/ Hx� Hx� /.�Hx�LHzE/ aG/ a�|$nN^Nu%s %s%c%c�NV/BHx� Hx� /.� /.�HzHna�)/.a�:$�� .g /�a�(XB $.N^NuMACB E �MACB �NV��pЮ�rdHz`Hza�rWIDN^NuPWD �NCSA�TCPC�HTFTP: Treating as %s server. �HTFTP: Treating as NCSA server. �HTFTP: Treating as Unix server. �HTFTP: Treating as VMS server. �HTFTP: Treating as Generic server. ��NV��H 0$n�&n� Hz8a�XOJm�(Hx�"Hy�AaG<POJgB tfHp 9�/�Afp$J�A g��"<� tf"<� /Hza/aGPOXO`��A�A �/fF/�a�XOJgt$J�A g��Hz`t$�J�A g��Hza/aG`lHhaGA�AXO 0�]�ft$�J�A g$Hz`BJ�A gHzaX/aGhPO"RtgAtdt f/a�L N^NuSITE DIRSTYLE �HTFTP: DIRSTYLE failed, treating as Generic server. �MSDOS� off�NV��H�8&n�$n� HzInNXOrgBJ�A gDHzaߠ/aG`0�HzHy�AE� N POgHz/�NPOJfHzDNL�N^Nuget_connection�%s@%s�Enter password for user %s@%s:�FTP�HTFTP: Interrupted on connect �HTFTP: Unable to connect to remote host for `%s'. �Connection interrupted.�Unable to connect to FTP host.�FTP connected, socket %d control %ld �HTFTP: Interrupted at beginning of login. � awaits your command� ready.�NetPresenz�anonymous�USER�HTFTP: Interrupted while sending username. �PASS %s%c%c�WWWuser�PASS %s@%s%c%c�HTFTP: Interrupted while sending password. �ACCT noaccount�HTFTP: Login fail: %s�HTFTP: Logged in. �SYST �UNIX Type: L8 MAC-OS MachTen�HTFTP: Treating as MachTen server. �UNIX�Unix�HTFTP: Treating as MSDOS (Unix emulation) server. �VMS�VM/CMS�VM �HTFTP: Treating as CMS server. �DCTS�HTFTP: Treating as DCTS server. �MAC-OS TCP/Connect II�HTFTP: Looks like a TCPC server. �HTFTP: Treating as NetPresenz (MACOS) server. �MACOS Peter's Server�HTFTP: Treating as Peter Lewis (MACOS) server. �Windows_NT�HTFTP: Treating as Window_NT server. �MS Windows�HTFTP: Treating as MS Windows server. �MACOS AppleShare IP FTP Server�HTFTP: Treating as AppleShare server. �HTFTP: Ugh! A Generic server. �NVH0<&.�BBJ9�@gB9�@ y�@Jg$ (�rg /�aG XO*y�@B�B-� `&Hx�Hx�a�%*HPOJfHzLHzadPOr+A�Jg�"CJg�Hx�Hz/a\F$HHx�@/ aG �Jg��(JB$HHx�:/ aG BPOJgB/ai$XOJg / aiXOJf��B/ / HzHna�!TPOPO 9�@g/�/.aG POJfJ�@fP/.Hy�@a�/ / HzHna�! � 9�@g/�a�B�@XO/.apL#�@XO$9�@ .g/�a�fBXOJfJg / a�PXOG�/ Hx�Hz8/a��R$@POPOJl��fJ�A g6Hza0/aG @PO` J�A g/Hza/aG POXOf��@dHz ae4|` Hz(abXO -�rg /�aG XOJg / a�XO�@fB�@Jg�/ a�|`�J�A g/ /Hza؀/aG POPO#�@/a�9a�tBa� $@POfJ�A g� Hz`�B�@rf��Hy�AaG ,XOrdXHzHy�AG� N$HPOJfHzHy�AN$HPOJgBE�AHx� Hz/ a�POXOJfr #�@`E�A/ "n� �/ a�nPO <� JgJg /�Hza�$@POfJ�A g�THzf`�<rf��Jg Hx� Hx� /HztHna��`��B y�@ Jg*Jg&/Hna�Hx�@/.aG POPOJg(B`*HzaGRXOJg/`HzHna�POa��N$HJgHx�./ aGPOJfE.Hx� Hx� / /.HzHna�� .g/�a�|BXO/.a�<$@XO .g/�a�\BXOg(Jg / a�BXOrfdHza�Z$@XOfPJ�A gHzwa2/aGBPO��@dHzLac� y�@/(�aG y�@r!A� `�rg&J�A gHy�AHzVa/aGp`�J�A gHzLaն/aGPOr �@gB�@B9�@Hz5a�>XOrf�6Hx�Hz&Hy�AEG!NPOXOJf"r#�@��@J�A g�Hz`�Hz+Hy�AG� NPOJfHzHy�ANPOJg(r#�@B�@��@J�A g�Hz`�XHzHy�ANPOJg"r #�@��@J�A g�Hz`�$Hx�HzHy�ANPOXOJf"r#�@��@J�A g�NHz`�Hx�HzHy�ANPOXOJgHx�HzHy�ANPOXOJf"r#�@��@J�A g�Hzm`�Hx�HzHy�ANPOXOJfr#�@J�A g�Hz``�fHzyHy�ANPOJgr#�@J�A g�tHzk`�\r �@f$��@Hx� a�dXOJ�A g�pHz_`� Hx�HzHy�ANPOXOJf,r#�@��@Hx�a� XOJ�A g�,Hz_`��Hx� HzHy�ANPOXOJf8r #�@J�A gHzja0/aG@POHy�@Hy�@a�B`��Hx� HzdHy�ANPOXOJf r #�@��@J�A g��HzA`>Hx�Hz^Hy�ANPOXOJf6r #�@��@Hx� a�TXOJ�A g`HzGaҖ/aG`LB�@J�A gHzLat/aGPOHy�@Hy�@a�r#�@`Hy�@Hy�@a� -�L< N^NuHTFTP: Closed master socket %d �close master socket�NV��//"9�@vg$A�Avƒp,�/9�@aG$�XOJ�A g/9�@HzaѬ/aGPOXOv#�@Jm ` Hz|a��=$.&.N^Nusocket for master socket�HTFTP: Opened master socket number %d �getsockname�HTFTP: This host is %s �bind�HTFTP: bound to port %d on %s �PORT %d,%d,%d,%d,%d,%d%c%c�listen�TCP: Master socket(), bind() and listen() all OK �NVH88EHx�Hy�Aa�"B�A"Hx�Hx�Hx�aG�$��lHza��<`�J�A g/Hza@/aGPPOXO4�Bx-DG/ / y�@/(�IG"NPOXOJmfJ�A g / a��= /Hza/aG�POPOBnHx�/ /aG>POXOJlHza��<`�0x-D/ / /NPOXOJlHzba��;`� J�A g(/ a��</B0./�Hzcal/aG�|�J�@ma�X#�@a��GHx� Hx� B./�B./�B./�B./�B./�B./�HzHy�AaG��$.���/9�@aGPOJlx#�@Hza��;0`JJ�A gHzaξ/aG&9�@$A�Arƒp㠁,� R�A"o#�A" LN^NuDec�Nov�Oct�Sep�Aug�Jul�Jun�May�Apr�Mar�Feb�Jan�9999%02d%.2s�%d�NVH�8BaG�R-@Hx�E/ I� bNXOHh�HnGG!NB.POPO .� f|�0Hx�/ NXOHh�HnNB.POXOG�@/Hna� HPOJg XKRJr lHnHj�HzXE/ GG!N/ EG NN#�A Hna�j.Hh�Hy�AaGlA�A�B� HhNS/�HzHy�AN��@L�N^NuNV��/ $n�Jg6 g /�a�BXO *�g/�a�B�XO *�g /�a�B�$nN^NuNV��"n�IA�AU�g��I�g��I�g�� �� g ��f��RI �� gIA�AU0��gxRIIA�AU0��gd � f^ �� g I0��gLRIIA�AU0��g8 ��:g I0��g&RIIA�AU0��g �� gI0��fB` B )� �fpN^NuDirectory�NVH 8&n� $n�J�@f:tF-BBBBBBt-BHna�nF#�At#�@XOJg��I ��mgTn �� g ��/g��`�� ��sg`��Hj�/ a�&`��` ��,gA�"I"@ARJJf'H� `zB` ��,g nA�I"@C-IRJJf$9�AծHna�g// aGB./ Hk�a��`HzHk�a�POJg �,gJfJf�&LN^NuNV��H<<(n�*.� tB/ aG&@SKXOx l*E�AU3�I2��gHta�XOJ�fSKx mB3�x lPHt$EPJ/ a�$R*�PO �� g ��0f|��*E m� (� � f2|� *E m��SIxmC1�IA�AU0��g,IxЄL�ր*BK,� $�ԂSI1�I0��f*E+C� Ht/a�nL<<N^Nu-> �Symbolic Link�NV��H<<$n�(n� *.�vB/ aGx$�XOf"E g(/�a�>"EB`/ a|&HXOJf/ /a�B,�`�rl$ *� �fIA�AU0��g��"EJf��IA�AU0��fB"E g4Jf0(B/aG TXO 0�/fHz`Hz0Hl�a�`�b/ / K� ,pNPOJgg +�/fHzHl�N`�"HzHl�`�t*� ��=g ��-fHztHl�a�&PO`<IA�AU0��g,2 �IrЁL�؀"CC<� &�փSB2 �I0��f)D� Hj�a�&HHx�Hzl/ aGPOPOJf +�g �� gHzPHl�a�B� POJBoB2 �/ a�/ GG!N$�POf"E QJgJg $H/ N$�XOJo( 2�/(f rlB2(J�fHzHl�a�>PO/ / a�2PO"E g /�a� B"EBL<<N^Nu �READ�ME�.ME�%.3s �%.2s �%c%.1s �%.5s� %.4s�HTFTP: VMS filename: %s date: %s size: %d �NVH0<$n�*n� $<� (`/ GG!NXOJgHx�;/ aG(HPOJfB-�`�B/ / a�lHzX/E� NPOPOJf/a/N&@PO`��Hz./N"U$HG�Hx�HzHs�aGp�Jf G� UJ3�g>A� �.g4RHRKJg,`Hx�Hz/ aG6POXOJf/aG&@XO`&֋/aXOSKvl U 3�z�f0 ��.g ��_f�Z�AHx� Hh�aGPOJg� ` LJ(�g $HC� � f � fRI`RJRKJfB0J9�@fa�BHx�-/ aGf$HPOJg�@/ aGfXOv d�.*IA�AU0��g�*�I�g� *�-�f��*�B�0���g /a�6XO@�*�B�A�AU0���g /a�XO@�Hj�HzHnGG!N*IA�AUPOXO0��gHjHzrHnNPOXO`HjHx�Hz`HnNPOPOHx�Hj�Hy�AaGPOXOJf"/ aGpXOvd *�:� f Hj� Hz"`Hj�HzHnaG POXOHnHm�a��POHx�// aG$HPOJg~(IC�AU1��gSH(I1��fcB/aG+@� A�XOIC�AU1��gRHI1��fBHj�aGL"-� XOef v +@� `Z// a�vPOJgJG�AU/Ba�`POJg4$HI"K1��gRJI1��fJf/aGv +@� XOJ�A g&/-� -�f <� /�/Hza/aG&L< N^Nu%.6s %.4s�%.6s %.5s�HTFTP: MS Windows filename: %s date: %s size: %d ��NVH8<*n� &n�/ aG( ؀/ &<��'"CN&HPOJfB-�`�:/ $<��'"BN$HB(J/ / G� ,pNPOXOc</ "CN$H/ "BN(HBIA�AUPO0��g/ aG+@� XO`Hz(`HzւHm�NPOJ9�@fa�θc��/ a(H/ aGPOrdpB,�B,� B,�E�/ Hy�AaGPOJg / / Hz` Hl� / HzHnaGPOPOHnE�/ a��T$R*�PO �� g ��0f|��J�A g&/-� -�f <� /�/HzkaR/aGbL<N^NuDIR�%.3s %.2s� 20%.2s� 19%.2s� %02d:%.2s�HTFTP: VM/CMS filename: %s date: %s size: %d ��NVH?<..�*n� &G/ aGI�BB/ *<��'"EN&HPOJfB-�`�/ (<��'"DN$HB/ / ,<� ,p"FNHx�./aGr�Jf�/ "EN&HXOJf$ g /�a�:BXO -�g/�a�(B�`/ "DN$HBHz/ a��POXOJf rlHzHm�"FNB� `(<�./ / a��<POc/ a/a$HBPOc��/ a&H/ a$HBIA�AUPO0��g / aGD&�XOcF/ a&H/ a$HBIA�AUPO0��g / aG $�XOJo JoL(�+B� J9�@fa�&Jc�@Hx�:/ aG,$HPOJg�* Wc� *�IA�AU0��g� *�I0��g�� *�:�f��VJB r l��GB*B*B*[J � f�0/ IG NNHk�A�@/0 HzpHn$<G!"BN� .�0f|� \K/ Hy�AaGvPOJg(/ NXOrEm/ Hz2`/ Hz3Hn"BNPOXO`B*�/ NHj�/�HzHn"BN�HnE�/ a��$R*�PO �� g ��0f|��J�A g&/-� -�f <� /�/Hza/aGL<N^Nuparse_dir_entry�HTFTP: Falling back to treating as Unix server. �..�.�can not access directory .�total �not available�.dir�.me�read.me�text/plain�application�x-��NVH0<&n�*n� BHx�a��l$HXOJfHz8Hz8aFPOBB�B�B� |�� 9�@Sv e�0; N���>������Jg`/ aG(@XOJg( � g"vl +� �f`8Hx� / aGnPOJg&v#�@J�A gHzaX/aGhPO`Bv�@fd/.�/ / a�POXO RJg��Jg��Hz/GG!NPOJgHz/NPOJfB*� j�Jg�Jf�/a�B�`� �+f/ / a�PO`�/ aG(@XOJgTHz0/ aGPOJg:BHx�Hz3/ aGPOXOJg Hz&/ a�uPOJfJ�@gB�@B*�`�BA�AU0��g/�a�XOvDg`vDfHz<Hj�a��<�PO`b �lf\Hz~Hj�a��<�" SPOvl>A�AU3�I0��g 3�>f 3�-f 3� gSvmvlB3/ / a� Hz-/GG!NPOPOJgHz/NPOJf��B*�`��/ / a�POJ*�g�/aGz(@XOvl��Hz RHpaGRPOJfv J"XB1HzJ/a��`P/ / a�zPOJ*�g�\`�*/ / a�:`/ / K� ,pN/ aG(@POXO 3�/fB3HzHj�N<�PO`/ / `�Jg J� gB� g��/�aGXOvdrHx�./aG&HPOJg^Hx�HzK/ I� +NPOXOJfD+�g ��;f8v�@f Vd&Hx�HzHkNPOXOJfHz Hj�a��POJ�fpHnHn/a&HPOXOJfFHx� Hz/+�IG!NPOXOJf$p Ы�-@Hx�Hz/�NPOXOJf T`-k�/.Hj�a�� J L< N^Nu9999�00:00�%02d�NVH0<*n�(n� 9�@vg0l�Pvg vg@`�@ m� ",� g�2pd�4p`�."-�g� ,�g�/�/a��PO`�� -�g�J�g�/�EG!NXOv f�/,�NXOf�J9�@fa� m� (�:� fBz8z3z.z)z$&-�^/HnaGPO .� f<|�0`4Hh�HnaGzzzzzzPOHx�/-�E/ aGB.ϗPOXO$ E�@//a��POJg XJRKv lHk�Hz/aG/E/ aGHx�&-�X// aG B..� �� g ��f|�0 .�9f.HnaG"9�A RXOlA�A�RKvlHnHnaG l�PO (�:� fBzzzzz&,�^/HnaGtPO .� f<|�0`4Hh�HnaGTzzzzzz|POHx�/,�E/ aG2B.ϗPOXO$ E�@//a��POJg XJRKv lHk�Hz1/aG/E/ aGHx�&,�X// aGB..� �� g ��f|�0 .�9f.HnaG*"9�A RXOlA�A�RKvlHnE/ aGFHn/ a��POPOJf //aG4L< N^NuReceiving FTP directory.�/�/foo/..�type=�read_directory: interrupted after %d bytes �read_directory: interrupted_in_next_data_char after %d bytes �Transferred %d bytes�HTFTP: Line in %s is %s �Adding file to BTree: %s � � * � %d bytes� %dKb�HTFTP: Closing data socket %d �close�Data transfer interrupted.�NVPH><&.�$.� B/.�/.�/a*HHx�Hz0/a5&H|�WBB U-X-X-X-X-X-X-X-X-P��@dHzVa@fB9�@�r�@f<�r‚/// a <�A(#�A,#�A(POXOJfHz#`Hz/ aG$POJfHz Hna��PO`��Hx�// aG"POr�@f/ `Hh�Hna��XO.���;/.aG$HPOJg��Hx�HzHj�a��POXOJfvB*�A�AU0��g /�a�XOrDgPB*�A�AU0��g /�a�XOrAg,B*�A�AU0��g/�a�XOrIg`rIfBJg / a�XOHzxa*Hx�a��(HBBRHx� / nNPOPO(<�A(/ a��TaXOJgJ�A gB/Hz`(t`�B�@a�p$�J�@gXJ�A g/Hza/aGPOXO<�Jf�/ nN/aPO .Rg /�a�NBR <`� � g � f��Jgr�@f�� y�A(�A,d (� �f|RH#�A(`�\Hx�Hy�A(/9�@a��.POXO f r#�@`�4Jo�Є#�A,#�A("D � f&#�A)�A(`�rgI// a��PO`�/ a��֔A�XOl /HzEX/ aGl/ a=j$CPOPOrfrg��J�A g/,� /.HzaR/aGbPOPOHnRHnW/,� a�&HPOXOJ+�gB .Rg/�a�BRXOJ�A g/Hza/aGPOXO/ /aPO`/ a�XOJg / a�XOrf�/ a��TXO .Rg/�a�BRXOa�PJg|BHxBBHx�V/ nNBHxBBHx�6/ nN�,.��� / nNa�// nNa�fBHxBBHx�6/ nN�$.��� / nNPO`&BHxBBHx�V/ nNHx� / nN� B`��&T +�g/�/ nNHz/ nNPOPO`Hz/ nNPO k�JgBJg6rm02�I// nNPORJ k�J2�f`Hx� / nNPORJrl//./ a// nNBB/ nN� +� g6 ��b/�Hz` r /�HzHnaGPOXOHn/ nNPOHx� / nN/ a�PO./a(HPOJf�BHx�V/ nN/ nN/aF� .g/�a�BXOJf r�@gLJ�A g/9�@Hzja/aGިPOXO/9�@aGPXOrf Hz_a��XOr#�@Jf aJg��@dHz;a:.p7F�L<|,N^NuHTFTP: Interrupted in response (port_command) �HTFTP: Port defined. �PASV�%d,%d,%d,%d,%d,%d�HTFTP: PASV reply has no inet address! �HTFTP: Server is listening on port %d �ftp://%d.%d.%d.%d:%d/�connect for data�FTP data connected, socket %d �%2�HTFTP: Rejecting path due to illegal escaped slash. �D�A�I�HTFTP: type=%s �HTFTP: UnEscaped %s �PWD�8bit�7bit�www/source�www/download�www/dump�TYPE�HTFTP: Rejecting path due to non-Unix-style syntax. �//�HTFTP: Trimmed '%s' �HTFTP: VMSized '%s' �HTFTP: Filename '%s' �[.%s�%.*s[%s]�%.*s[000000]�%.*s�000000�%s:�/~�LIST�check '%s' to translate x/y/ to [.x.y] �[.%.*s]�change path '%s' �...to path '%s' �vmsysu:�anonymou.�NLST�RETR�accept�TCP: Accepted new socket %d �150 Opening ASCII mode data connection for /bin/dl. �HTFTP: Treating as "dls" server. �221�identity�binary�www/compressed�x-compress�gz�x-gzip�Receiving FTP file.�HTFTPLoad: normal end; �control socket is %d �closing control socket %d �control connection close�NVH?<B.B~B9�@B�@BBa6BPOB/.� /.�a�"$�POm�J9�@ 'f��a�~$�m�\Hy�Aa�ú$�XO f2J�A gHza/aGPO��@dHza5`�rg Jm�Z`�.J�A g�\Hza/aGٸPO`�D#�@Hza�Ŗ$�XOrg Jm�D`�hA�AJg �,gRHJfSH$<�Ad� �� bSHeHnHnHnHnHnHnHz<Hh�a�^� rl�~ .@n3�A&J�A g8�/Hz@a/aGPOXOB09�A&/�/./././.Hz7HnaGٚHy�@B09�A&/�Hz|/.�a��! $��,m�J�A g./9�@Hzav/aG؆POXO`Rrl�$Jm�Hx�Hz/.�a)-H(BPOXOr�@f��Hz/a�a$HPOJgnB*�A�AU0��g/�a�HXOrFg`HrFfBJg /a�XOa� y�@/(�aGך y�@r!A�XOJ�A g�Hzn`� nJfHzHna��V*<� CPO`��Hx�;/aG؜*POg��Hx�HzcHh�a��hPOXOJf��*E-�B�A�AU0�(�g /a�XO`���rDgmrAg`,rIg`$*EB*<� C`*EB*<� C`*EB*<� C`*<�  nJf �/ nB(�*EJg J�A g/Hza/aGPOXO/.a5XOJ�A g/.Hza/aG֠POXO n (�~�f��BHx�/Hh�aGZ$HPOJgBHzva�\XOrf�� 9�/�Afz*nRM/ Hza�vPOrfb*nRM/ G/ a��POJg0�//.aG nXO 0�/g/ `Hj�/ a��$POJg /a�XO .-@(�Jg�//.aGֺXOrd��Hx�./.aGֺ$HPOJgjHx�Hz;/ G� +NPOXOJfP*�g ��;fDr�@f .Vd0Hx�HzHjNPOXOJfBBHn/.a,�.`BHn/.a,PO./.� /a*,BHzE� NPOPOgHz NXOg<�JfXHzE� NXO�gHzNXO�gHzNXO�fr�@g<�JfJg*E �If<�`JgJg *E �AfB y�@(� g> <� CJg <� C/�Hza�$�POrga�J l�D`� y�@C� 9�@rg rg�`�BHx�:/.EG!NPOJfHx�[/.NPOJgPJg /a�XOa� y�@/(�aGӐ y�@r!A�XOJ�A gHza/aGӰp`�Hx�Hz/.aGԔPOXOJf�<� nJ(�g�RI nJ0f nB1�J�A g/.Hza6/aGFPOXO/.Hza�$HPOJ�A g/ Hza/aGPOXOHx�]/ aG&HPOJg�fRK/ /.aGPOJ�A g/.Hzza/aGPOXOB/ HzQIN$�POrg�BHx�[/ aG~&HPOJg��B/ HzN$�POrg:Jg /a�@XOa�j y�@/(�aG y�@r!A� l�D`�/ HzHna��f/.HzN$�� .g/�a�BXOrg�PJg /a�XOa� y�@/(�aGѢ y�@r!A� l�FD`�@Jg /a�XOa� y�@/(�aGh y�@r!A� l� D`�Hx�:/ IG!N&HPOJg�"Hx�[/ NPOJf�Hx�]/ NPOJf�RKJg�/ /.aG6POJ�A g/.Hza/aG,POXO/./ $ /HzG/ a��:/.HzI0N�rg��/ /Hz/ a��/.HziN�rg�/ /Hz/ a��/.HzCN$��rg��Jg /a�bXOa� y�@/(�aG: y�@r!A� l�D`�Hz:/ `��*nRM/ / aG4POJf��/ HzGnNPOrg`/ Hz Hna��R/.HzN$��rg:Jg /a�XOa� y�@/(�aGϤ y�@r!A� l�HD`�BHzHna��-nPO/.EG!NXOrd"/.N nXO 0�/f/N nB0XOHzc/.EG!NPOJg0JgHz>/.NPOJg/.aGDXOrf^ n �/fT|�Hza�&$�XOJg /a�XOrg�za� y�@/(�aGξ y�@r!A� l�bD`�\Hx�Hz/.aGPOXOJfTJ�A g/.Hza/aGβPOXOJf�@Hx�//.aGx$HPOJg� Hx�// aGό&HPOJg��rl��BHj�HhHzoHna��POPOJ�A g/.HzYa$/aG4POXOHx�//.aG*POJg�.`J�A g/.Hz/a/aGPOXO/.Hz{a�$�PO .g/�a�BXOrg:Jg /a�XOa� y�@/(�aG` y�@r!A� l�D`�RK-K`�Jf�`�/.aGbXOrf n �/g��Hx�Hz*nRM/ a��6POXOJf*Hx�.".R/GG!N$HPOJgHx�// NPOJg:Hx� HzQ*nRM/ a��POXOJf��Hx�/".R/aGPOJf�� nJ(�gBHh�HzYa�$�POrg,a� y�@/(�aG` y�@r!A� l�D`�|�J9�@gHz``Hza�f$�XOJg /a�.XOrg�a�P y�@/(�aG y�@r!A� l�D`�RHx�//.aG$HPOJg��B/.Hza�4POrfJfh|�J9�@gHz`Hz-a�$�XOJg /a�XOrg,a� y�@/(�aGh y�@r!A� l� D`�a�`��-J`�`Hx�Hz/.aGrPOXOJfRJg*E �Dg/.Hza�$�PO`trgNHz/.aGPOJga�&/.Hza�P$�POrf |�J9�@gHz`HzKa�$�XOJg /a�ߴXO .g/�a�ߤBXOrg,a� y�@/(�aGr y�@r!A�Jm� `�J9�@ 'fZr-AHnHn/9�@aG$�POXOla�nHza��`�@J�A g/Hza:/aGJPOXO#�@J.g��r�@fBJ�@f:HzHy�AaGPOJf$J�A gHza/aGPOr#�@/.�/.�/.�/.� a�&�POPOo@r�@g8 SJo0Ba�P$�XOm"rfHx�HzvHy�AaGʔPOXOJfB 9�@rg@J�A g/�Hz(aV/aGfPOXO/9�@aGXOrf Hza��XO$`�Hx�Hz/.�a&Ha�/ a'zPOPOJgrHzI� NXOg^HzNXOgPHzNXOgBHzNXOg4*F/-�*n� Hm�hE� ,pN n/(�Hm�pNHzN,�`��/ aGɈ$�XOrl�� 3�Z(fX3(� ��c �_fBB3(BHn/ a~Hx/.� /a\/(�*n� Hm�hE� ,pN�.� E`rrl��Hz Hs(a��҈POJfl3(� ��c �_fVB3(BHn/ a~ZHx/.� /a/(�*n� Hm�hE� ,pN�.� EHm�pNHza��,POXOJg / a�bXO��@dHza#V/.�/9�@/.� /.�/a�$@ y�@/(�a���JlPrfS`grfBJ�A g/9�@Hza/aGPOXO/9�@aGƾ$�XO`tJlgrgHza��(XO`x���gpSrghBa�`$�XOrg0g(rg"#�@a�Hy�AHx/.�a{t`�hJo"rfHx�HzNHy�AaGlPOXOJfBv7F`0Jo4Ba�$�XOrfHx�HzHy�AaG4POXOJg SJnr#�@J�A gHz2a/aGPO y�@ (�lzJ�A g��/�Hza/aGPOXO`�� y�@/(�aGz y�@r!A�a�ž `��Hza/aGŚp`nHza���/9�@aG8`J�A g/�HzaR/aGbPOXO y�@/(�aGXOrf Hza���XO y�@r!A�a�$ L<N^NuNV�� 9�@g/�a�B�@N^Nu��TCP: Error %d in `SOCKET_ERRNO' after call to %s() failed. %s �NV��/$9G ,J�A g&/a�//.�/9G ,Hzat/aGĄ#G , D$.N^NuNV��H 8&n�$n� R� �� ct`0C�" RI(@CR R� �� c޳�b `t&BLN^Nu%d.%d.%d.%d�NV�� n�B(�/�B(�/�B(�/�B(�/�HzHy�A0aGĚA�A0 N^NuNV��H0 2|�B n�Jg4Jg0BE�AU���nX ��.fJgB`@Jf ��-g ��+fB`NRv?m�C(�f ��-g ��_g ��$g ��+fRHRIJfBg ��.f JgJ(�ft L N^Nu%s: %p �{ h_name = %p� "%s",�,� h_aliases = %p� {� �, �%s %p "%s"�%s0x0 }, �, � h_addrtype = %d,� h_length = %d, � h_addr_list = %p��%s %p�"� "�.�%s%d%s�, 0x0 } }� 0x0 } }�}� ��NV��H 8(n� J�A g�/ /.�Hz,E�N/GG NPOPOJg�J�A g/Hz N/NPOXO gJ�A gH/�HzN/NPOXO`J�A g.HzN/NPOJ�A g/,�Hza/aGPOXO$,�g��J�A gHza/aGPO&BJg<J�A g.// <� ]�f <� ]/�HzaR/aGb�XKJfJ�A g�� l� <� ]Jg <� ]/�Hz^a/aG&POXO`J�A gnHzIa/aGPOJ�A gR/,�Hz-G�N/EG NPOXOJ�A g,/,� HzN/NPOXOJ�A g/,�HzN/NPOXO$,�g��J�A gHzax/aGPO&BJg��J�A g,/ <� ]˷�f <� ^7/�Hza>/aGNPOPO",� oZBJ�A gFA� <� ^7f <� ^>/� S2�/ <� ^CJf <� ^@/�Hza/aG�RJ",� nXKJf�b l�JgJ�A gLHzN`J�A g>HzJ` J�A g0HzEa/aG濠POJ�A gHz+at/aG濄POad/aGPLN^NuLYGetHostByName: Can't parse `NULL'. �LYGetHostByName: parsing `%s'. �LYGetHostByName: INTERRUPTED for '%s'. �End of LYGetHostByName�LYGetHostByName: Resolved name to a hostent. �LYGetHostByName: Can't find internet node name `%s'. ��NV��/$.�f(J�A gHz�aJ/aGZ#|�@ `�J�A g/Hza /aG0POXOa@Jg*J�A g/Hza/aG#�@ `��/a�2XOJ�f#j�@ r#�CH`��J�A ga/aG潜XO#|�@ /a�8 XOf #�@ `2B�@ $�/Hza�$POJ�A gHza\/aGl B`J�A g/Hza</aGL $.N^NuHTParseInet: Can't parse `NULL'. �HTParseInet: parsing `%s'. �HTParseInet: INTERRUPTED for '%s'. �Address has invalid port�Address length looks invalid�HTParseInet: Parsed address as port %d, IP address %d.%d.%d.%d �HTParseInet: Can't find internet node name `%s'. �NVH 8&n�$n� BBJf J�A g�2Hza/aG�`�J�A g/ Hza/aGPOXOaJg"J�A g�/ Hza/aG滴`�/ Hna��NHx�:/.aGtPOPOJgZB-H� �� bHx� Hn/a�H7@�POXO nJg(Jg$ .g/�a�BXOHzdBan`�T n� �� bD-HJg<C�AU n ��.fR` I1��g nI�-LJ(�f nJgBrf/.a�J'@�XO`B/.a�B$HXOJg��r� gHz/.aPO j�/*� /Hk�aGPOXO .g/�a�BBXOJ�A g:B+�/�B+�/�B+�/�B+�/�B0+�/�Hza /aG0B`LJ�A g/.Hza/aGPOXO .g /�a�B 9�@ g jgpLN^NuTCP: Local host name is %s �NV/ J�@fBHx�!E/ a�/ Hy�@a��8POPOJ�A g/9�@HzaZ/aGj$nN^NuNV��a y�@ N^NuLooking up �%s%s�Invalid hostname %s�Unable to locate remote host %s.�Making %s connection to %s�socket failed.�Could not make connection non-blocking.�this socket's first connect�Connection failed (too many retries).�this socket's first select�failed select�confirm-ready connect�confirm-not-ready connect�*** INTERRUPTED in middle of connect. �this socket's first and only connect�Could not restore socket to blocking.��NVH><&.�$.�*.�IBBHx�B/ aG8�=BHx�Hz/a$Hx�@/aG4� JgHh�`/Hna��POJg /a�XO/.HzHzE/ G� 6N��@d/.K��|N/./ a�&��gp g< jf/.HzaPO`/.Hz/ N��@d/.NPOPOvF .g/�a�dBXO .g�/�a�NB`�/./.� Hzh/ N��@d/.N� .g/�a�BXO .g/�a�BXOHx�Hx�Hx�aG湞"E"POXO|fHz!`�|-FHn/<f~"E/aGDPOXO|f��@dHzNXOHx�Hn"E/aG2&�POXOl� 9G ,|8g| f�vBHza�XOE L< fffg |젒R�@ l�`B-|�Hx�/ a�H"E $�rᡃ,HnB/ BHx�aG$��|f Hza�hXO|f |G ,g��JlHza�HXO|9G ,f��JoFHx�Hn"E/aGN&�POXOl |LG ,fBJg��|9G ,fB`>Jl��Hzc`~Hx�Hn"E/aG&�POXOl 9G ,|9g | g|LfBaJg,J�A gHzIaF/aGVPO&<|#G ,`Jo�`&`Hz`Hz:a�nXOJl"E/aG`DHzza pF�`6BHn/<f~"E/aGDPOXO|f��@dHz a L<|N^NuHTDoRead - refusing to read fd 0 which is a tty! �Socket read failed for 180,000 tries.�read��NVH?8*.�(n� &n�BJf*BaG波XOJg&J�A gHzpa/aG(`Jnp`��a0Jg` Hzxa r#G , <`��BE&|̅ R �np$�B-|�Hx�/ a�Ӧ<HnBB/ Hx�aGJ�rf rG ,gJm�jnaJf�xJg/ / /aG $�POXOrfrG ,gHza� LN^Nuutf-8�NV��H00&n�&.� J�lvHx�/E� !N$�POlHx�/N$�POl$9�@UHx�Hx�//E� !NHx�Hx�//N�.���/a��'H�Hx�/+�a��t'@�POPO/+�/+�/+�/+�E/ aB�J�@gr'A`BJfJ+f J+fJ+g'k�`$J+fJ+gHza'@`'y�@zL N^NuNV��H88$n�Hx�/*�I� !N&�PO�gLJmHHx�/*�G� N(POg2Hx�/*�N$Hx�/*�N%D�%C�%B�%@�/�/*�/ a�LN^NuSGML: Unknown attribute %s for tag %s ��NV��H<0$n�*.� j�&h��g��B((�oP  �jR$Ԁ//3,�a��POJf%B��(/ 2,TgF/�a�B,T`8Jl&R`(mJ�A g j�//HzNa~/aGr%A�L <N^NuSGML: Attribute value %s ***ignored ��NV��/ /$n�".� *�tg/Hr Ta��D`J�A g/Hza~l/aG|t%B�$.$nN^NuNV��"n� .� J)�f< ���f i�Hx�`6 ���f i�Hx�`$ �� g �� g �� gB` i�Hx�/)� h� NpN^Nuzwnj�zwj�handle_entity: Ignoring '%s'. �lrm�rlm�SGML: Unknown entity '%s' %ld %ld ��NV��H88&n�.�t k�"&(� B9�@/ae8$@XOJg�~/ / a� POJ�f��/+�/ aZ$�POrl* ���n"r~l +�A�@b �m k�I/`��rgJ+gX SreNB/+�/ Hx�<Hy�ADa$�FԂD�g&E�ADJg\ k�I//+� h� NPOJf`@J+g/ k�/(� /+� aPOXOJ�fAr^e k�2 I//+� h� N��@`��Hzx/IG!NPOJgHzi/NPOJfJ�A g/HzUa|,/aG<`Hz`/NPOJgHzV/NPOJf J�A g/Hza{/aG`�zJ�A g// /Hza{/aG� k�Hx�&/+� h� N$C` k�I//+� h� NPOJfJg k�I//+� h� NLN^NuSGML Comment: <%s> �!--#��NV��H 0$n� j�"$(� J�A g/Hza{0/aG@POXOJ:f@Hx�Hz/aG"POXOJf(G6/ /*�aPO ��fHj://an` j�"/(� /*�aL N^NuSGML Identifier: <%s> ��NV�� n� h�" (� J�A g/�Hzaz/aG櫖N^NuSGML Doctype: <%s> �NV�� n� h�" (� J�A g/�HzazB/aGRN^NuSGML Marked Section: <%s> �![INCLUDE[�![CDATA[��NV��/ / $n� j�" (� J�A g/�Hzay/aGPOXOHx� Hz j�"/(� GG!NPOXOJf& j�""P h� B0 j�"r Ҩ� /Hj*a��`:Hx�Hzv j�"/(� NPOXOJf "j� j�"rҐ/ h� PH//*� i�N$n&nN^NuSGML Entity Declaration: <%s> ��NV�� n� h�" (� J�A g/�Hzay/aGN^NuSGML Element Declaration: <%s> �NV�� n� h�" (� J�A g/�Hzax/aGN^NuSGML Attribute Declaration: <%s> �NV�� n� h�" (� J�A g/�Hzax`/aGpN^NuNV��/ n�$n� .�JgJfp`LJg *�` *�Jg"(�`"(� f��g �g0|� `�g *�g2|� $nN^NuNV��"n� n� JfB`&(���+gp`g (��$VID`�%N^NuSELECT��NV��H00&n�$k�&Jg��J+�gHz j�/a��POJfB+� k�$*� 뀐 @A�" v砐"BC � DrOvum"� k�Hk*//+� h�N'R�&POXOJg/ a� k�&Jg h�(�+��@`B�@�L N^NuNV��H>8&n�*.� $k�&xJg^&*�gJ k�$"E 뀐A�A�" |I � D|Og Љg` ��Hf ` $RRJfBL|N^NuSGML: </%s> ignored �supplied,�***forced by�SGML: End </%s> <- %s end </%s> �none�SGML: Still open %s, ***no open %s for </%s> �SGML: Nesting <%s>...<%s> <- ***invalid end </%s> �SGML: ***Ignoring end tag </%s> in SELECT block. �SGML: End </%s> �SGML: ***Illegal end tag </%s> found. �SGML: Found </%s> when expecting </%s>. </%s> ***assumed. �SGML: Found </%s> when expecting </%s>. </%s> ***Ignored. �SGML: Restart <%s> �SGML: Continue with other content model for <%s> �SGML: Extra end tag </%s> found and ignored. ��NV��H<<(n�$n� / / a�\&�POJ9�@ f�&J�&g��zmJf��Jf6*��+g.Hx� l�&/(�/ a�POXOJ�gJ�A g�8/Hz`� l�&/(�/ a�$�POgdJ�A g6/ <� ywzf <� ym/� l�& h�/Hzpas/aG椦�/ a�/ / a�&�POXOJgJ�&gzm�PJf4J� g.J�A g�// l�&Jg h� ` <� y/�Hz+`� zl J�A g�n/ l�& h�//Hz3`��J,�g*HzZ/a��~POJgJ�A g�6/Hz;`�B,�J�A g/HzWar/aGPOXOJ� fJ�A g�/Hz@`� ,�&g�(�"D )�f&J`B l�&$� 뀐 @A�" z렐"BC � Dzum&C`&C gR l�&Jf&J�A g�~///Hz$ar/aG,`�bJ�A g///Hzaq/aG� l�$ 뀐 @A�" z렐"BC � D4|�Ozum$@ l�K*/ / /,� h�NPOXO ��f<J�A g/Hzaq|/aG梌POXO l�/ /,BB/ /,� h�N`j ��fPJ�A g/Hzaq8/aGH&l�&zOg l�C� 倐 PA �'H�`" l� PH'H�`"D)Q�&Jg/a� l�&Jg h�(�+��@`B�@�`J�A g/HzAap/aGL<<N^NuSGML: End </%s> <- %s start <%s> �SGML: Still open %s <- ***invalid start <%s> �SGML: Still open %s <- ***ignoring start <%s> �SGML: Still open %s, ***converting invalid <%s> to </%s> �OPTION�SGML: ***Faking SELECT end tag before <%s> start tag. �SGML: ***Ignoring start tag <%s> in SELECT block. �SGML: Start <%s> �start_element�../../../WWW/Library/Implementation/SGML.c�NV��H?<(n�&l� l�$ 뀐 @A�" ~*BK � D&�B<�B4|�J9�@ f�J�&g�`�f��~΄/ l�&/(�/ a�`�POXOf�� l�&/(�/ a�$@POJgTJ�A g6/ <� yw~f <� ym/� l�& h�/Hzan`/aGp�/ a�<�XO~f.B`*J�A g"/ l�& h�/Hzan /aG0POPO l�&Jg�.~g�>~g�. l�&Jg�JfN h�(��+gB~΄/// a��POXOf,J�A g�/ l�& h�/Hz^am/aG枺`�J�&g��JffJfbJf^+��+gVBB$+�o4/RoJgJf8J�A g$// l�& h�/Hz(amD/aGT�/ / a�`�. l�&JgF~f@΄//(�/ a�POXOJ�f*J�A g"/ l�& h�/Hzoal/aGPOPOJ,�fHz2/a��VPOJf��|��`��Hz/a��8POJg��~<g2e~(g*e~`~,g` ~[ge~Be~Ab `~if<�Jg:J�A g/HzwalR/aGbPOXOHz/,�a�F// a�POPO`"J�A g�$/Hzral/aG&`� J�A g/Hzak/aGPOXO"l�Hl*/,Hl�THl�/ l�$ 뀐 @A�" ~*BK � D/�/,� i�N� ��fD l�"P$ 뀐 @A�" *BK � D~Og Ђ` ��H&@J� g:Hx�a�$HXOJfHzHza&$�&%K�)J�&+�+�@G�` ~Kf/ a�L<N^NuNV��H8<&n�(n� B(+�oH  �jR$C/ SK� 倐$�/0(�a��<POJf S`*Jl& R`( mBC�AUA�A L�f L<N^NuNV��H00$n� *"g/�a�8B"XO *6g/�a�$B6XO *:g/�a�B:XO **g/�a�B*XO *.g��/�a�B.`z j�&$(�%P�&Jg /a�XO"j�Hj* j� 뀐 @A�" v砐&BG � DrOvum"�//*� i�NPOXO **g/�a�jB*XOJ�&f�~ j�/*� h�N/*�"a��iBPO 2,Tg/�a�2B,TXORv#lJg/ a�L N^NuNV��/ /$n� j�/.� /*� h�NPO *"g/�a�B"XO **g/�a�B*XO *.g/�a�B.XO *6g/�a�B6XO *:g$/�a�B:` j�&%P�&Jg /a�vXOJ�&f/*�"a��iBXO 2,Tg/�a�RB,TXORr#lJg/ a�8$.$nN^Nu</�>�UCTransUniChar returned 0x%.2lX:'%c'. �SGML: Found PI in PCDATA, junking it until '>' �SGML_character: Handling 'zwnj' entity as 'WBR' element. �<WBR>%c�<WBR>�%lx�%ld�SGML_character: Handling '8204' (zwnj) reference as 'WBR' element. �&#x�&#�SGML_character: Ignoring '%s%s'. �SGML: `<%.*s/' found! �URL�URL:�SGML: Treating <%s%c as text �SGML: Found PI, junking it until '>' �SGML: *** Invalid element %s �SGML: *** Unknown element %s �!DOCTYPE�!ENTITY�!ELEMENT�!ATTLIST�SGML: found = but no value �Unknown end tag </%s> �SGML: `</%s%c' found! Ignoring it. �FORM�SGML: ***Faking SELECT end tag before </%s> end tag. �P�SGML: `</%s%c' found! Treating as '<%s%c'. �SGML: `</%s%c' found! ��NVH?<(n�-l�*l�"BB.�BJ,g� �c��J,�oJ ��� ���f: ,r?ƒ)@S,� l lG�)KJ,�f�&TB(�*,`�FA)HRI ��� ���f |��~`f ��� ���f |��~`L ��� ���f |��~`2 ��� ���f |��~` ��� ���f|��~΃)G`�%B,�)HB`�%B,�A)HBJ,g: ,�A�@b �l~m�2JgJ,g/�I/a*�POo�`J~m�Jg�J,g��J,g@/,�I/E�C`N*�POmJ,g /,�/N*�POo ���n��`��J,g0B/,�/,�I/Hx�<Hy�ADa$��J,gJl(Hx�/,�/,�I/Hx�<Hy�ADa$��Jg�$mLC�ADgBA�AEJg8J�*f $I l�I//,� h� NPOJf`�$T/Hl"a��TPO`BB,B~m� ��c � g J�@g�" �f J,f ,�A�@b �l J�@g�"pЅ~e J,f ,�A�@b �l J�@g�"~�@f|~'�*ft �?c( �g" �b,�.�� ��cR�� ��cF,�.��_ ��]b ��_ ��]c* �f ��_ ��>c l�I//,� h� NB�*PO ,�*~)e�"�0; N���\"HR>z xVT L ` | ! !@!b!0!l!!!!�T!!B�* l�,�.I//,� h� N l�I//,� h� NPOPO`�!p �>f J�g~~lB�*J�@g*Jl~')G�*C�.`�!@ �f~)G�* l�Hx�`� �&g �<f l�&BJg-h� �&f6~~m0Jg&n"k� A~d ~g~f B~ )G�*`� �<f:~~m4BJg&n +� ~f~`S~e~`~)G�*B�`� l�Jg| �/g �>fp~�*fh~~mb�gJ� f(��+gJ"fHzHl"a��B&`HzHl"a��rPO l�/G"/ E� ,NHz/ NPOPO`�v l�&Jg�� h�(��+g��J,gJ,g l�E/ /,� h�N`��J�@f`J,fJ,gT �c�d ��f(Jg$J9�@gB ,�A�@b �m�A�/`/ l�/(� /,� aPOXO`�fJg�J,g� l�I/`� ���f J,�fJ,fJ�@f l�Hx�`� ���f J,�fJ,fJ�@f l�Hx�`�J,gJg l�I/`�BJ,g ���o<�Jg��/,�/a$�PO~l: ���n2J�A gI//HzUa^/aG揢POPO l�I/`�6Jg`~gJ,gT S~eJB/,�/Hx�<Hy�ADaB�Jm*E�ADJg�6 l�I//,� h� NPOJf`�J,g/ l�/(� /,� aPPOXOJ�f� _~^e��J9�@f��J,gJ,gzJ�@fr&l��@zgf l�Jg(�� fVB&EHk`aXOJg$HI// a��^TPOJf/ a��aB/ a�BPOXOJ9�@f�` l�Hx�;`� S~}d�J,g6J,g0EJg l�I//,� h� NPOJfA)HB`� B ,�A�@b �m�J,g�J9�@g�`�Jf@~~m: �!f~ )G�*|��B,�B,�Hx�!`� �?fJ�A g� XHz`� @I// a��]\PO l�&BJg-h�BA�AU0��g/�a�XO"�`B"U~g&n S0If `�:~/g�2 �>f.Jg( U&nJ(f l�&/(�/ a�B~)G�`� ~&nྫ� g+��+f~�*f��p &n�(g�� ~l�� �>g~mBA�AU�gz~)G�* UG*SHo m� �RJm~fBA�AU�f�j`2BA�AUC�f�T �_g�L� ��c�> �:g�6S`�.~�*f&p &n�(g~fBA�AU�f� p l�Hx�</,� h� NPO`"l� m� 2�I//,� i� NPORJ SnBB�*`� �#f ~ )G�*`�~)G�*~~m.JgBA�AUC�f�h`BA�AU�f�RJf l�Hx�&/,� h� NB�*PO`�N/ a��^Hz\/-� aG4POXOJf�� l�&Jg h�Jg��~� fzJ�A gHzaZ/aGPO �;gI/Hz8HnaGPOXO`Hz,HnaG拰POJ"fHnHl"a��xB&`HnHl"a��POB`�B/ a��POBB�*J9�@g�`�~~mhBA�AU0���g/�a�XO~xg`~xf|��~ )G�*`�>~~m(BA�AU0��gI// a��YB,�~ `�Jf� l�Hx�&/,� h� N l�Hx�#/,� h� NB�*POPO`�~~m.J,�gBA�AUJ0�m�`BA�AU0��f�JfF l�Hx�&/,� h� N l�Hx�#/,� h� N l�Hx�x/,� h� NB,�B�*�`�Z/ a��\XOJ,�g HnHz/-� a�POXO~g"`�\HnHz/-� a�POXO~f�>"n~g A~e� S ���b�0; N�6BNZfr~-|��&:`��-|�� `��-|�� `��-|�� `��-|�� &`��-|�� `��-|�� !`v-|�� 0`l-|�� 9`b-|�� `X-|�� `N-|�� `D-|�� `:-|�� "`0-|�� `&-|�� `-|��`-|��!"`-|�� : �� f�� l�&Jg h�Jg��~� f~J�A gHzaU/aG憺PO �;gI/HzHnaGlPOXO`HzHnaGXPOJ"fHnHl"a�� B&`HnHl"a��POBB,�`�</./ a�POJ�f�H/,�/.a2$�PO~l* ���n"~~l ,�A�@b �m l�I/`�p~gJ,gV S~eLB/,�/.Hx�<Hy�ADa�Jm*E�ADJg� l�I//,� h� NPOJf`�J,g /. l�/(� /,� aPOXOJ�f�~"nA~d�� fdJ�A g�^ UG* S~?lp?/�/-� Hy�ADaHy�AD <� \J,�g <� X/�HzaS/aG�`����nL~mA~d~ gJ�@g.~fJ9�@fJ�@gpЮ~e��J9�@f~ l�Hx�&/,� h� N l�Hx�#/,� h� NPOPOJ,�g l�Hx�x/,� h� NB,�PO UG*SHo�J l�"m� 2�I//,� h� NPORJm`�$ ���o$J9�@f&l��@zg l�Jg(�� g l�.I/`^ .`-@/�aXOJgRJgNB$HI// a��SxPOJf/ a��VB/ a��POXOJ9�@f�� l�Hx�;/,� h� NPO`�� l�Hx�&/,� h� N l�Hx�#/,� h� NPOPOJ,�g l�Hx�x/,� h� NB,�PO UG*SHo" l�"m� 2�I//,� h� NPORJmBB,�B�*`�BB,�B�* �;f�`�SI// a��R/ a��V l�Hx�&/,� h� N l�Hx�#/,� h� N�J,�g l�Hx�x/,� h� NB,�POJ"f/-� Hl"a��"B&`/-� Hl"a��POBB,�`�>~~mLJg4BA�AUC�f� �_g�� ��c� �:g�`BA�AU�f� �!f Jf\~ )G�*|��B,�B,�Hx�!`�Jf< ���n4 �/g4 �?g( �_g" �:gB�* l�Hx�</,� h� NPO`� �/f2 f ~)G�*`�vJ�A g/-� /�Hz3aP\/aGlPOPO/ a��T/-� /.a�H$HPOXO�f�� �:f~fHz/-� a��POJg"~l��Hx�Hz/-� a��POXOJff l�Hx�</,� h� N l�/-� /,� h�N l�I//,� h� N�J�A g//-� HzaO/aG怨POPOB`� �/fJg)J�Jf` �?f,~m&J�A gHzkaOV/aGfPO~))G�*`�DJ�A g/-� HzgaO,/aG<POXO �>f� f`��f"J�A g/-� HzQaN/aGPOXO)J�/*�BHl�/aGzB~)G�POXO �>g �<g �/f�VJ�g�N l�Jg/ a�vXO �>g� �<f ~)G�*`�~)G�*`�J,�g> �-fB,�|��Hx�-`�H �[f B,�|��B,�Hx�[/ a��O~`�(J,�g$ �-fB,�B,�B,�Hx�-/ a��N~`�B,�B,� �>f/ a��RP/ a�LB`� � b� ~f0Hx�HzI/-� a��POXOJfI// a��NB,�~`�~f6Hx�Hz/-� a��POXOJfI// a��NTB,�|��~`�b~f� PHx�Hz/-� E� +NPOXOJfI// a��NB,�|��~`�"~f� Hx�Hz/-� NPOXOJf� I// a��MB,�|��~`�J9�@ 6g �>f��/ a��Q6/ a�ф`�J,�f �-f6`� �-f,Hx�-/ a��MB,�POJ,�g�J9�@ 7f� B,�`� J,�g �>f/ a��P/ a�$`�B,�J,�gIA�AU0��fB,�J,gJ,f�nJ�@fFJ,fJ,g: ��f�Jg�J9�@g�B ,�A�@b �m��A�/`�Jg� J,g� I/`� J,�g I// a��LPO �]f� B,�`� �[f& U� (� bHx�[/ a��Ln|��PO`� �>f� n/ a��O/ a�B`�J,�g" �[fHx�[/ a��L.B,�|��PO`� PJ,�g2 �]f$ U� (�]fHx�]/ a��KB,�PO`� J,�f� �>f� / a��O\/ a�B`�J,�f �-f(`�� �-fHx�-/ a��KB,�POJ,�g��`�,J,�g �>f/ a��O/ a�ш`��B,�`� J,�f �-f$`J �-fHx�-/ a��KPB,�POJ,�gd`�J,�g �>f/ a��N/ a�т`lJ,�f �-fBHx�-/ a��K |��PO`� 2 �-f$Hx�-/ a��JB,�POJ,�f�v|��`� J,�g�X �>f�P/ a��ND/ a�fBB,�B,�B�*PO`� � c� �>f�� l�Jg� / a�ڈXO`� � c� ��b� ~/ a��M/-� / a�BPOXO �>f l�Jg� p/ a�@XO`� d �=g4~)G�*`� X � c� P �>f l�Jg� </ a� XO`� 0 �=f ~)G�*`� $I// a��I~)G�*PO`� � c�  �>f2J�A gHzaH/aGyPO l�Jg�/ a�٤XO`� �'f ~)G�*`� �"f ~)G�*`�~ )G�* � c �>f>/ a��L/-� / a�BPOXO �>f l�Jg�n/ a�>XO`�b~)G�*`�\J,gJ,f�rJ�@fFJ,fJ,g: ��f�Jg�J9�@g�B ,�A�@b �m��A�/`�Jg�J,g�I/`� �'f"/ a��L0/-� / a�*B~)G�*POXO`� �f~)G�*Hx�`�J,gJ,f��J�@fFJ,fJ,g: ��f�Jg��J9�@g��B ,�A�@b �m���A�/`��Jg�.J,g�&I/`�" �"gJ9�@ 8g0 �>f*/ a��Kt/-� / a�nB~)G�*POXO �>g��`� �f~")G�*Hx�`�J,g J,gE/ / a��K6)JBPO`�J�@fLJ,fJ,g@ ��f(Jg$J9�@gB ,�A�@b �m�A�/`// a��HPO`�pJg�LJ,g�DI/`�@~~mLJg4BA�AUC�f� �_g�� ��c� �:g��`BA�AU�f�/ a��JR m� XOJf l�&Jg$h�`//.a�$HPOJg�f(J�A g�/-� HzjaE/aGvPOXO`�B �>g � b<� l�$ 뀐 @A�" ~&BG � D-@z)J� l�-P$ 뀐 @A�" &BG � D~Of` l�&JgX"nH�fJ$H(.$ 뀐 @A�" ~&BG � D~um Ђ` .�� %@�Jg� J9�@ g�~qe��&n0;N�������������������������������������������������������������������������������������������������������������������B`zJ9�@ g�Jg�Jf<J�A g I//-� HzOaC/aGtPOPOB~)G� �>f�`�\~f�`J,�gtHz</-� a��~POJg$J�A g�*/-� Hz͋aC(/aGt8`� J�A g/-� HzaC/aGtPOXOHzT/,�a�// a�ΘPOPO`hHz/-� a��~\POJfTJ�A g&I/�/-� /�/-� HzaB/aGs�B`B4/R l��m l�Jgt/ a�PXO`jJ�A g/-� HzaBb/aGsrPOXO"l�Hl* l�$,� 뀐 @A�" ~&BG � D/�/,� i�NPOXOB~)G� �>fL`�/,�/ a�ͤPOB~)G� �>g� � c&J�A gI//-� HzaA/aGrPOPO~()G�*`� �$f~`H �(fH~`> �@g6� ��c* �(f0~`" �Cg` �Bg �Jg �Tg �If~)G�*`B�* l�I//,� h� NPO`�8 �f~)G�* l�I//,� h� NPO �n�`� �$f~`��~ �(f��~`�� �@g � ��b~ `�� �(f��~!`��~ �Cf��~ `��~ �Bg�� �Jg�� �Tg| �Ifv~ `r �fp~`h �$f~#`^~ �(fV~$`R �@g � ��b~%`< �(f:~&`2~ �Cf*~%`&~ �Bg �Jg �Tg �If ~%` �f~")G�*I// a��@PO` �>fB�B�* l*JgXJf/a�B*XO`D l.Jg."l2J1�gHq�Hl*a��}PO ,.g/�a�B.XO)l*.B2B* l"Jg("l&1�g �RI)I&`�x/a�\B"XOB& l.Jgp"l21�f/a�8B.XOB2`R&l�@gJ,g4-HHnaz*�XO ���bB n.RH)H2`��RI)I2`� l:Jg&"l>1�g �RI)I>`�/a�B:B>L<N^NuNV��/ /$.�$n� JgI/�/a�POJf$.$nN^NuNV��H0 &.� .� $�Ԯ�$@cI//a�PObL N^Nu� t� B� � � � $SGMLParser�SGML_begin�NV��H 0$.� &n�HxBa�l$HXOJfHzHzΧaPO$� \Hx�a��<%H�"%n��%K� %S�%|�A L�B�B�B�*B*�.B�&B*�B*�XOp#B TQB@SdB*�B*�B*�B*�B*�B*�B*�%B�B*�BB* B*C%IHja$Hx�/G� !N%@�POXOl"HxBHx�/a��pHx�/N%@��Hx�/a��n %H�Hx// a�B"B&B*B.B2B6B:B> J L N^Nu����������������������������������������������������������������NV��H 0$n�&n�.� .� �f&��_ ��>bBA�@"p � p ��`L N^NuNV�� n�`8Jl4 ��?c, ��g& ��b �� ��cJg�� ��bp`fBN^NuNV��/ n�.� .�B �b�`��O��R �cS �cR`B� $.N^NuNV��/ n�.� .����g�`�} �~cR���tЂ� ��c��@A� $.N^NuNVH8� .� $.�.� A@ �fHnHnB@�BA�a�~POPO/.xƄ/.Ƅ/a�X B L�N^NuNVH 0$n� &n�/ / B.� /�Hx�a�0Hnt‚/‚/a�L N^NuNV��/ $n�/ B.�/�B.� /�a����*�� J $nN^NuNV��H<0$.�*.� /a�(�&B$EXOgjB+�J�@gV �?cP �gJ �bD�� ��bx`Jg0�� ��b$/ /BB�a�����*��TJTKPOXO`fB E L <N^NuNV��H80&.� $n�&CJg4Bl&*�g"l / ���/xȁ/a�TKTJPOXO`RJJfB C L N^NuNV��H?0..� ,.�*.�B&n�$GB`��Jlj��_ ��]b ��_ ��]c �f ��_ ��>c �fJfVR`PJfP// aGj/ aGjPOXOJl0��` JgF// aGjV/ aGjTPOXOf�nJg// aGj2/ aGj0JgB G L N^NuNV��/ /$n� "R n�`B(�g@TH �(f �Bg �Jf$`*� ��]b� ��]b����f $.$nN^NuNVH?<*n� R�A@B$n�-MB6|�$8|�(/ a�.�BXOg�jB �g�Z �fJf�Nf2Jf.J�@g& ��Bg ��@fHnHj�a� POg$@`� �fPBf*� ��Bg ��@f4<�TJR`��fB*� ��Bg ��Jg ��HfTJ`�� �,fBJlR ��?cL ��gF ��b@�� ��b~`Jg,�� ��b /.B/�BB�a�`TRPOXO`dJgF� ��]c nR � fDB`@� ��]b( nR nRJ`Jf � ��c nRf� nB M L<N^NuNV��/ n�`6J�l0B(�Jl tt ltgpt ltfB` RHRHBfp$.N^NuNV��H8�&.�(.� /aGgR/�a�x$//a�/a�~�Jg //a�` //aGgVXO.a�{,L�N^Nu(B�$B�NV��H 0$n�&n� JfB`>/ aGg R/�a�xl$// a�^/a� HzHz/ /a�� .a�zL N^Nu��yuml�yen�yacute�uuml�uml�ugrave�ucirc�uacute�trade�times�thorn�thinsp�szlig�sup3�sup2�sup1�shy�sect�reg�raquo�quot�pound�plusmn�para�ouml�otilde�oslash�ordm�ordf�ograve�ocirc�oacute�ntilde�not�ndash�nbsp�middot�micro�mdash�macr�lt�laquo�iuml�iquest�igrave�iexcl�icirc�iacute�hibar�gt�frac34�frac14�frac12�euml�eth�ensp�endash�emsp�emdash�egrave�ecirc�eacute�divide�die�deg�curren�copy�cent�cedil�ccedil�brvbar�brkbar�auml�atilde�aring�amp�agrave�aelig�acute�acirc�aacute�Yacute�Uuml�Ugrave�Ucirc�Uacute�THORN�Ouml�Otilde�Oslash�Ograve�Ocirc�Oacute�Ntilde�Iuml�Igrave�Icirc�Iacute�Euml�Egrave�Ecirc�Eacute�ETH�Dstrok�Ccedil�Auml�Atilde�Aring�Agrave�Acirc�Aacute�AElig�URN�TYPE�TITLE�TARGET�TABINDEX�STYLE�SHAPE�REV�REL�ONMOUSEOVER�ONMOUSEOUT�ONCLICK�NOTAB�NAME�MD�LANG�ISMAP�ID�HREF�DIR�COORDS�CLEAR�CLASS�CHARSET�ACCESSKEY�NOWRAP�WIDTH�VSPACE�HSPACE�HEIGHT�DOWNLOAD�CODEBASE�CODE�ALT�ALIGN�NOHREF�SRC�LOOP�VLINK�TEXT�ONUNLOAD�ONLOAD�LINK�BGCOLOR�BACKGROUND�ALINK�VALUETYPE�VALUE�REF�OBJECT�DATA�CITE�ONFOCUS�ONBLUR�DISABLED�VALIGN�SPAN�CHAROFF�CHAR�USEMAP�UNITS�PARAMS�NOFLOW�IMAGEMAP�BORDER�ISOBJECT�SIZE�FACE�END�COLOR�SUBJECT�SCRIPT�ONSUBMIT�METHOD�ENCTYPE�ACTION�ACCEPT-CHARSET�SCROLLING�NORESIZE�MARGINWIDTH�MARGINHEIGHT�LONGDESC�ROWS�COLS�COMPACT�SKIP�SEQNUM�DINGBAT�NOSHADE�FRAMEBORDER�ONSELECT�ONCHANGE�MIN�MAXLENGTH�MAX�ERROR�CHECKED�ACCEPT�PROMPT�CHALLENGE�FOR�MEDIA�BOX�HTTP-EQUIV�CONTENT�N�ROLE�STANDBY�SHAPES�DECLARE�CODETYPE�CLASSID�START�CONTINUE�SELECTED�Y�X�VALUEREF�ACCEPT-ENCODING�SCRIPTENGINE�LANGUAGE�EVENT�MULTIPLE�NOTATION�TO�INDENT�DP�SUMMARY�RULES�FRAME�COLSPEC�CELLSPACING�CELLPADDING�ROWSPAN�COLSPAN�AXIS�AXES�WRAP�PLAIN�� �A����������������w�{�`O���� �A8����������O�� w��������� �A8����������O�� w��������� �AH�����������O��f� o������ �Al�������� ������ �0����� �A���������������������������� �A8����������O�� w��������� �A8����������O�� w��������� �A8�����������O� � w�������� ׹�A8������������������������� ״�A������������������������������� ׫�A��� ����������������w������� ק�A8�����������O��f� o��?����� ן�A��� ����������������w��s���� כ�A8����������O�� w�������� ו�A8�����������O�� w�������� ׊�A��� ������� � � f� o������ ׅ�A8������������������ ���� |�Ax������������ ��� ����� y�A��� ������� � � f� o������ v�A8�������������������w������ o�A�������� �����7��7��_����� g�A��� ��������O���j�� o�_����� `�A������������ f� o������ �A8�����������O�� w�������� G�A8����������O�� w��������� \�A@��� ������@����������� �o�_���� S�A@��� ������� ��@���@�����o�_���� K�A8������������������ w��������� D�Ax�����������O���j�� ������ A�A8����������������� o����� =�A8������������ ��������� 9�A8������������w��������� �A ��������������_�v�o�O����� 5�A������������ f� ����� 2�AX�����������Ā��f� ��_����� .�AX�����������Ā��f� ��_����� +�A8������������O����������� (�A8�����������O�� w�������� "�A��������� ���� o� ����� �A\����������O��g� �_����� �A��������������f� o�O����� �A|������������ f� ~�O����� �A��� ��������O�� w�������� �A������������o���n�/������ �A������������������������� ���� �A,���������� ��� ��� ��� 0�� ����� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A8������������p�������� ���� �A��� ������@������������7���� �A8������������������������ �A8�������������������w������ �A8�����������O�� w�������� �A��� ����� ���� g� o� 3_����� �A �������������������w�������� �Ap��� �������@����������?��O���� �A8������������ ��������� ־�A�������������������w������� ֺ�A8������������������w��������� ֳ�A����������@�������������p���� ֭�A8��� ��������0O����g�o�������� ֦�Ad��� ��������O����� �������� ֣�A8����������������� ����� ֠�A��� �������������� ����� �A��� ��������������������������� ֘�A8������������������f��o������� ֔�A������������������������ ֌�A8��������@������w� �0����� և�A�����������_��w��������� ւ�A ��������������_�v�o������ }�A<������������������������������ v�AL����������������������������� m�A8�������������p��p���_����� h�AT��� ����������v� ������ �A�������� ���� g� o�?_��� � e�A��� �����������v� ������ ^�A ��� ������������������@������ V�A P��� ������@��������������?���� T�A ��� ���������O��f� o����� N�A �������������������5���`���� D�A8������������ ��� ������� @�A8�����������O��^�f�o������ >�A8����������O�� w��������� <�A8����������O�� w��������� 7�A8����������O�� w�������� E�A �������� ������������_����� 0�A 4���������@��������?�?�_���� ,�A8�������������������w������ &�A8����������O�� w�������� �A8����������O�� w�������� !�A8��������������������������� �A8����������O�� w��������� �A8�����������O�� w�������� �A ������������������c�o������� �A8����������_��w��������� �A8����������_��w��������� �A ��� ����������������w�������� �A �������������f� o������ �A ��� ������� ��� ���� �_���� �A 0���������������� � �_���� �A ���������@�����������?�_���@� �Ax����������� � w� � ���� �A ��� ������� ��� ����� �_���� �A 0����������������� � �_���� �A ��� ������� ��� ����� �_���� �A8���������������������������� � �A ��� ������� ������ � �_���� �A8�����������O�� w�������� �A8�����������O�� w�������� �A �����������Ā��f� �_����� �A8����������O�� w��������� �A8�������������������w������ �A8������������������g�o��_���� �A�������� ���� g� o�?_���XMP�WBR�VAR�UL�U�TT�TR�THEAD�TH�TFOOT�TEXTFLOW�TEXTAREA�TD�TBODY�TABLE�TAB�SUP�SUB�STRONG�STRIKE�SPOT�SMALL�SHY�SELECT�SAMP�S�Q�PRE�PLAINTEXT�PARAM�P�OVERLAY�OPTION�OL�NOTE�NOFRAMES�NEXTID�META�MENU�MATH�MARQUEE�MAP�LISTING�LI�LH�LEGEND�LABEL�KEYGEN�KBD�ISINDEX�INS�INPUT�IMG�IFRAME�I�HY�HTML�HR�HEAD�H6�H5�H4�H3�H2�H1�FRAMESET�FORM�FONT�FN�FIG�FIELDSET�EMBED�EM�DT�DLC�DL�DIV�DFN�DEL�DD�CREDIT�COMMENT�COLGROUP�COL�CENTER�CAPTION�BUTTON�BR�BQ�BODYTEXT�BODY�BLOCKQUOTE�BLINK�BIG�BGSOUND�BDO�BASEFONT�BASE�BANNER�B�AUTHOR�AU�AREA�APPLET�ADDRESS�ACRONYM�ABBREV�A��� �A���������������w�{�`O���� �A8����������O�� w��������� �A8����������O�� w��������� �AH�����������O��f� o������ �Al�������� ������ �0����� �A���������������������������� �A8����������O�� w��������� �A8����������O�� w��������� �A8����������O� � w�������� ׹�A8������������������������� ״�A������������������������������� ׫�A��� ����������������w������� ק�A8�����������O��f� o��?����� ן�A��� ����������������w��s���� כ�A8����������O�� w�������� ו�A8����������O�� w�������� ׊�A��� ������� � � f� o������ ׅ�A8������������������ ���� |�Ax������������ ��� ����� y�A��� ������� � � f� o������ v�A8�������������������w������ o�A�������� �����7��7��_����� g�A��� ��������O���j�� o�_����� `�A������������ f� o������ �A8����������O�� w�������� G�A8����������O�� w��������� \�A@��� ������@����������� �o�_���� S�A@��� ������ ��@���@�����o�_���� K�A8������������������ w��������� D�Ax�����������O���j�� ������ A�A8���������������� o����� =�A8������������ ��������� 9�A8������������w��������� �A ��������������_�v�o�O����� 5�A������������ f� ����� 2�AX�����������Ā��f� ��_����� .�AX�����������Ā��f� ��_����� +�A8�����������O����������� (�A8����������O�� w�������� "�A��������� ���� o� ����� �A\����������O��g� �_����� �A��������������f� o�O����� �A|������������ f� ~�O����� �A��� �������O�� w�������� �A�����������o���n�/������ �A������������������������� ���� �A,���������� ��� ��� ��� 0�� ����� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A|�����������O��_�f������� �A8������������p�������� ���� �A��� ������@������������7���� �A8������������������������ �A8�������������������w������ �A8����������O�� w�������� �A��� ����� ���� g� o� 3_����� �A �������������������w�������� �Ap��� �������@����������?��O���� �A8������������ ��������� ־�A�������������������w������� ֺ�A8������������������w��������� ֳ�A����������@�������������p���� ֭�A8��� ��������0O����g�o�������� ֦�Ad��� ��������O����� �������� ֣�A8���������������� ����� ֠�A��� ������������� ����� �A��� ��������������������������� ֘�A8������������������f��o������� ֔�A������������������������ ֌�A8��������@������w� �0����� և�A�����������_��w��������� ւ�A ��������������_�v�o������ }�A<������������������������������ v�AL����������������������������� m�A8�������������p��p���_����� h�AT��� ����������v� ������ �A�������� ���� g� o�?_��� � e�A��� �����������v� ������ ^�A ��� �����������������@������ V�A P��� �����@��������������?���� T�A ��� ��������O��f� o����� N�A �������������������5���`���� D�A8������������ ��� ������� @�A8�����������O��^�f�o������ >�A8����������O�� w��������� <�A8����������O�� w��������� 7�A8����������O�� w�������� E�A �������� ������������_����� 0�A 4���������@��������?�?�_���� ,�A8�������������������w������ &�A8����������O�� w�������� �A8����������O�� w�������� !�A8��������������������������� �A8����������O�� w��������� �A8����������O�� w�������� �A ������������������c�o������� �A8����������_��w��������� �A8����������_��w��������� �A ��� ����������������w�������� �A �������������f� o������ �A ��� ������ ��� ���� �_���� �A 0��������������� � �_���� �A ���������@�����������?�_���@� �Ax����������� � w� � ���� �A ��� ������ ��� ����� �_���� �A 0���������������� � �_���� �A ��� ������ ��� ����� �_���� �A8���������������������������� � �A ��� ������ ������ � �_���� �A8����������O�� w�������� �A8����������O�� w�������� �A �����������Ā��f� �_����� �A8����������O�� w��������� �A8�������������������w������ �A8������������������g�o��_���� �A�������� ���� g� o�?_����A���v�@ ���pHTMLDTD: Copying DTD element info of size %d, %d * %d ��NV��/.� J�A g"Hx�,Hx�wHxtHza/aG3�Jg HxtHz`HxtHzVHy�AaG4J$.N^NuNV"n� n� ".�pB6QB@SdJgJg |�-HJg |�-A QBHxHnHnB/ h�NN^NuNV/ $n� n� ".�"n�pB6QB@SdJgJg |�-HJg |�-AJg |�-I RB/.�HnHnB/ h�N$n|N^NuNV"n� n� ".�pB6QB@SdJgJg |�-HJg |�-A QBHxHnHnHx�>/ h�NN^Nucreation of chunk�../../../WWW/Library/Implementation/HTChunk.c�NV��/ Hx�Hx�a�L"$HPOJfHzHzaB� %n��BB� J $nN^NuNV��/ /$.� Hx�Hx�a�K$HPOJfJg`$HzNHz\aB� %n��BB�%B� J $.$nN^NuHTChunkCreate2�HTChunkCreate2: requested %d, allocate %d �HTChunkCreate2 data�NV��H00$.�&.� Hx�Hx�G� :N$HPOJfHzHza PO%B�JgV SLB�R Ђ%@�J�A g/�/Hz_a/aG0POPO/*�Hx�N%H� POfHzbHzTaB J L N^NuNV��/ $n� *� g /�a�EfB� BB�$nN^NuNV��/ $n� *� g/�a�E<B� XOJg/ a�E*$nN^NuHTChunkPutc�NV��/ /$n�.� *�nNЪ�%@�"*� g /�/a�GZ` /�Hx�a�IPO g%@� `J�g/ a�D`HzHzva"j� R�R$.$nN^NuHTChunkEnsure�NV��/ /$n� n� �oN"S$*�LB�R Ђ%@�"*� g /�/a�F` /�Hx�a�I`PO %@� fHzHzaD$.$nN^NuHTChunkPutb�NV��H0 $n�&.� Ro|�o`"S$*�LB�R Ђ%@�"*� g /�/a�F>` /�Hx�a�HPO g%@� `J�g/ a�(`&HzHzZaPO//.� "j� / aG/8גL N^NuHTChunkPutUtf8Char��NV��H8 $n�&.� xmt`< ��nt`0 ��nt`$ �nt` nt` B nt Ђ"*�lX *�o Ё%@�"*� g /�/a�EP` /�Hx�a�GPO g%@� `J�g / a�:`�Hz>Hzjaxe��0;*N�����,�>�P�b"j� R�`��"j� R ��`F"j� R x ��`4"j� R x��`""j� R x��`"j� R x���R Uxex0; N��Z�F�2�� "j� R����R"j� R���R"j� R���R"j� R���R"j� R��?���RLN^NuNV��B/.�a�nN^NuNV��/ / &n�$n� JgI/�/ a�JPOJ�gRJJf$n&nN^NuNV��H 8&n�$.� J� l&Hx�BHx�/a��.Hx�/a��-'@� �J�lTHx�/I� !N$@POJl$y�@UHx�Hx�/ /a��-POPOHx�Hx�/ /a��,Hx�/N'@��Hx�/E� N'H�Hx�/N'H�LN^NuNVH?0$n�.�@~ �A xf �� f ~#�A x`�z. �g. �_g(J�A |f B�A x�A { � fHx� `�> �~cHx�Hn/ a�`�0J�@gI/`�� ��!bJ9�@gI/`��. �fHx� `�� �g��� ��^c � ��b*I/`�� *�A�@Y, p �/0,�/*�aZPO`�� �c��J9�@f��"j��@zgv j�(�� fjzB"@Hi`a,/aG+d&@B(9� rPOo<  �jR$Ԁ/ / y� n/0,�aG+>*�POXOg�^l&R`(mJg.I//*�aüL N^NuNV��/ /$.� .� g$@JgI//a�,POJf$.$nN^NuUCTransUniChar returned 0x%.2lX:'%c'. �U%.2lX�us-ascii�HTPlain_write: Ignoring '%ld'. ��NV��H?<(n� .� ,�ܮ�*@c�  ��f` 9�A x~l2~ g,~ g& 9�A |f ~#�A |`�~f ~#�A |`�~�A |lHx�_/,�a¨POB�A |`" ��_fJ�A |f~#�A |~_#�A x`�z~ �A xf � f ~#�A x`�^J�A |gJ �c& � g � gB"9�A xg(~_g" �_g~�A |l^Hx�_/,�aPO`L 9�A |~f B�A |`�~f �_f*~#�A |`�~fHx�_/,�aPO �_g�B�A |B�A x�A { �� fHx� `��B&DBJ,�,g�D~d�J,�o^ ��� ���fN ,�r?‚)@�S,� l�& l�&C�)I�&J,�f�@B(�&l�A���b��4 B`�� l�&C�)I�&I ��� ���f |��~`f ��� ���f |��~`L ��� ���f |��~`2 ��� ���f |��~` ��� ���f|��~΂)G�`�B,� l�&BC�)I�&`�nJ,�oB,�B,�C�)I�&&DJ,�,gJm�<J,�2g< ,� A�@b �l~m�Jg J,�3g/�I/aI&@POJo��`L~m��Jg��J,�3g��J,�5gF/,� I/E�C`N&@POmJ,�*g&/,� /N&@POJo���n��4 B`��J,�*g0B/,� /,� I/Hx�<Hy�AaJ$@�J,�*gJl(Hx�/,�/,� I/Hx�<Hy�AaI$@�Jg�Bm"A�AgJ9�Ag//,�a`�B,�B,�B&GJ�@f�A~!eJ,�*f ,� A�@b �mJ,�0f�η���fJ,�0f����fHx� `����fHx�`�A~^d�J9�@f J,�1gJ,�5fI ,�A�@b �l�h� ��c�ZA~d�� fHx� `�DJ,�.g JgI/`�2BJ,�5g ���o<�Jg�"/,�/ aAn$@PO~l8���n0J�A g> I// Hzza./aG$>POPO> I/`�Jg��~gJ,�4g> S~e4B/,�/ Hx�<Hy�AaA�JmHy�A/,�a~`�Jg~~lxJ,�-grJ,�gE�/ /,�aTB)J�&`�THy�A/ anPOJ�gHy�A/,�a&`�,/ HzHy�AaG$BHy�A/,�a��`�Jg ,�A�@b �mJ,�5g��J9�@f��HzE�JNXO�V�DgpHzvN/�/ a@ $@POXO~l~~m > I/`��Jg@~f:BHz>aL./ Hx�<Hy�Aa@�JmHy�A/,�aJ`PA~d A~e>J�A g6/ Hzan/aG"~POXO`Jg ���bI//,�aPORMb�L<N^NuNV��/ $n�p�A |lHx�_/*�aPOJg/ a�6$nN^NuNV��/.�aN^Nu� � � � � � NPlainPresenter�HTPlain_new�../../../WWW/Library/Implementation/HTPlain.c��NV��H 0$.� Hx�6a�3&HXOJfHzHzaz^PO&� r#�A xB+�B�B+�%B+�$B+�C�'I�&Hx�/E� !N'@�Hx�/N'@� // a�Hx�/a�� //+�/+�/+� Hk�*ag�0.a'H�Hx�ua//+�a/+�a K L N^NuNV��p"n�A�PB�YHQB@SdN^NuNV��/ / $n�pЪ�/�G� / /*� j�N%K�/ aBFB*K$n&nN^NuNV��/ $n�".� .�g A� �fB�C�#j��J�gS�A�@KFmJ*Jf A� �d%AF$nN^Nu,;:.��NVH0<&n�.�J+ag�� �b��S� ��c �f��Hx�&/ aHx�#/ aHx�x/ a� �g n �g `Z �g<`RHx�A/ aHx�0`:Hx�2/ aHx�0/ a�|Hx�0/ a�rHx�2/ a�h� `Hx�A/ a�XHx�D/ a�NPOPO<�; k�R� � f / a�`�nJ+`fv � g � fj8|�A�!�dLzzzzz k�(I/E/ aG POg(@\LJ+bfPLTLHx�/ / a�RPOXO"+�K �cJ+Jg��JFg�� +Fg��A �"h�(IA�J(KgRL� kFA� h�HhE� / /+� k�N kFA� h� L�dر�eBFBA$"K )�gd #@�'AF`B�XIRvlB+KA �B+J`"/E� / /+� k�N'J�/ a��|�JL< N^NuNV��/ /$.�$n� JgI/�/a�POJf$.$nN^NuNV��H0 &.�$n� Ю�c$�I//a�\PObL N^Nu="�='�"�>�NVH?<&n�(.� ..�k`"DCJ� 倐 y� fA �&|�`Hx�</ IN"C// E<NPOPOJg�&BB"C�l�, *J(n�"GJ1(�g��<�Hx� / "FNHx�Hx� / a�F"C i�/0,�/ N�Jg��n`|�bHx�"/aGPPOJfHz$/ N// NHx�"`$Hx�'/aG*POJfHz/ N// NHx�'/ "FN�`BHz/ N$TPOJg& ��"g I/�/ a� ` Hz/ a�LPORJJfHx�"/ a�PO|�`B+bXLR"C�m�JgBHx� / a�bPOXOHz~/ a�POrVgn``|�`J+`f6"CJ� g. y� f"DCJ� 倐r fBHx�`BHx�/ a�rOfRr"C� fHJg<"GJ)�f<J)�g"n� i�8JgJf&"GJ)�fJ)�g"n� i�XJgJf <��`BL<N^Nu</��NV��H�8(n�&n� J,`f4 y� fC� 倐 0 grfBHx�`BHx�/ a�TPOXOHz/ EN y� fC� 倐/0 �/ NHx�>/ a�rVfB,`BL�N^NuNV��H8 &.�(.� $9� rHx�&/ENNPOo y� n/0L�/a�POHx�;/NBLN^NuNV��/ $n�Hx� /*� j�N/ a�^/*� j� NPOPOJg/ a�.$nN^NuNV��/$.�BHx�V/a�/a$.N^NuNV��/.�aN^NuNV��/.�aN^Nu� R� � � �� � L� � � bHTMLGen�HTMLGenerator�../../../WWW/Library/Implementation/HTMLGen.c�NV��/ / $n�Hxda�+d&HXOJfHzHzaqPO&� .'J� R'X�'X� 'X�'X�'X�'P�E� 'J�/ a�'J�BFB+JB+KB+`B+bJ9�@ frP`2 9�@ Nrl'@�`$J9�@ .grP` 9�@ JU'@�r%mr('A� ���orN'A� ����o'|����y�@ a K $n&nN^Nu� � �  � �� � L������������plaintexttoHTML�PlainToHTML�<HTML> <BODY> <PRE> ��NV��H 0&n�Hxda�*$HXOJfHzHzdapPO$� %K� S%X�%X� %X�%X�%X�%P�C� %I�/ a�BFB*JB*KXO"9�@ NpPtl %@�Hzf/ a�|�`B*aB*b J L N^NuHTAtom_for�../../../WWW/Library/Implementation/HTAtom.c�NV��H <(n�J9�A fpdA�ABYHQB@Sd��A / aGBL�"�L<DoW"�ԁ&BC�" C�" G�" &@A�A8$p�XOJg/ /*�a�� POJgj$RJfHx�K� 3 N$HXOJfHzHz#ao:PO/ aG8R/�N%H�POfHzHzaoPO/ /*�aGA�A8$�!� J L<N^Nu*�NV��H�8 .�&n� g��Jg��/�Hy�A E� ,pN/ Hy�A NHx�//9�A EG!N&H�Jg`Hx�//9�A N$HPOJgLBBHz/9�A IG!NPOJg/9�A /9�A NPOJfHzh/ NPOJg / / NJfp`BL�N^NuNV��H80&.�a��L$J9�A g>Jg:G�A8(<�A$SJg"//*�a� POJ�g / /a��PO$RJfXKl B L N^Nu��NV��H8 "n�Jg>BA�$�ԃ"L<�("x @E� E� A �  BJf LN^NuHTParentAnchor_new�../../../WWW/Library/Implementation/HTAnchor.c�NV��/ Hx�Hx�a�.$HPOJfHzHzal%J� B�(B*�WB*�XB*�YB�ZB�^B�FB�bB*�fB�hB�lB�pB�tB�xB�|B�B�B�B�B�B�B� J $nN^NuHTChildAnchor_new�NV��/Hx�Hx�a�-p$POfHzHz alX B $.N^NuNV�� n�"n� Jg$Jg Jgg fRHRIJfW`B`WIDN^NuHTAnchor_findChild called with NULL parent. �Child anchor %p of parent %p with name `%s' already exists. ��HTAnchor: New Anchor %p named `%s' is child of %p �NV��H�<*n�(n� Jf J�A gHzDaH/aGX`��$m�JgNJgTJgPJg $j�Jg&RJg</ /+�a�POJ�gJ�A gt/ / / Hza/aG`Za��+H�a�X&HJ�A g&/ f <� /�/ Hza/aG�/ /-�a��V'M� / Hk�a��L K L<�N^NuEntered HTAnchor_findChildAndLink �*** Duplicate ChildAnchor %p named `%s' with %d links�, same dest %p and type, keeping it �, different dest %p, creating unnamed child ��NVH<8(.�(n� &n�*.�/ /a�D$HPOJ�A gHz&aߚ/aGPOJg�Jg�/a� &Hx�// aa>-HBBBB.B.Hna�l&H�Jg��Jg��$g��/*�a��RXOJ�A g/�/ / Hza/aG �f(�f"J�A gF/ Hza/aGPOXO`,J�A g/Hza/aGPOXOB/a�D$HPO// / a� BPOXO .g/�a�$rBXOJg/a�$` J L<N^NuEntered HTAnchor_findAddress �HTAnchor_findAddress�Anchor %p with address `%s' already exists. �New anchor %p has hash %d and address `%s' �NVH0<(n�Hx�Hz0/G�q~N$HPOXOJ�A gHzFaݮ/aGPOJghHx�Hz/N-H-l�-l�-l� l�l�Hna/ /a�$� .g/�a�#2BXOJg/ a�# B`�XJg / a�#XO/a�d$�XOJ�A f(Hx�Hx�ea�(#�A POfHzHzafPO y�A J,�fa��"y�A #,� y�A &0,�&CKzJg &k�Jg$SJgL//*�NPOJ�g/,�/*� NPOJ�g*�X,�fJ�A g��// Hz;ap/aG `��a�>$HJ�A g/// Hz>aF/aG V�/Hj�G� ,pNPO ,�g /�Hj� NPO ,�g /�Hj�$NPO ,� g /�Hj�(NPOl��Xl��Y/ /a�� J L< N^NuNV-n�BBBB.B.Hna� N^NuNV��H�8(n�Jg�� TJg<$h� B j�JgJ�g / /a��POJ�fg� g/ a��XOB� l�Jg��J�gl/,�a��&&HXOJgF S$h� j�JgJ�g / /a��rPOJ�fg � g/ aDXOJg/ a� XO` ,�g /�a��NB�XO ,�g /�a��:B�L�N^Nur�NV��H�8(n�JgZJ�fTJ,�VfN|��V/ a�XO l�Jg>J�g8 l�Jg&J�g &HJg &k�Jg$SJg / a�XO`B,�VB`�D l�Jg@J�g:/,�a��$HXOJg(/ a�~XO *�g/�a�B�XO/ a�XO`B,�V ,�g/�a��`B�XO ,�g/�a��LB�XO ,�Jg/�a��8B�JXO ,�0g/�a�B�0XO ,�6g/�a�B�6XO ,�:g/�a�pB�:XO ,�>g/�a�\B�>XO ,�Rg/�a�HB�RXO ,� g/�a�4B� XO ,�$g/�a� B�$XO ,�(g/�a� B�(XO ,�Bg/�a�B�BXO ,�Fg/�a�B�FXO ,�Zg:Hz6/�aG POg/�aG /,�Za�PO ,�Zg/�a�B�ZXO ,�^g/�a�B�^XO ,�bg/�a�|B�bXO ,�hg/�a�hB�hXO ,�lg/�a�TB�lXO ,�pg/�a�@B�pXO ,�tg/�a�,B�tXO ,�xg/�a�B�xXO ,�|g/�a�B�|XO ,�g/�a�B�XO ,�g/�a�B�XO ,�g/�a�B�XO ,�g/�a�B�XO ,�g/�a�B�XO ,�g/�a�B�XO ,�g/�a�xB�XO ,�g/�a�dB�XOJ�A g(/,�a��� y�A XO 0 �g / /�a��PO ,�g/�a� B�XO ,�g/�a� B�XO/,�aXOJg/ a�pL�N^NuNV��/ /$n� j� g$(�/ /a��:/ /a��$.$nN^NuNV�� n�BJg (� @N^NuNV�� n�Jg!n� �N^NuNV�� n�BJg (� @N^Nu%s#%s�NV"n�BJg2 i� g )�f/(�Hna��`/�/(�HzHna�� n N^NuNV�� n�Jg!n� �,N^NuNV�� n�BJg (�, @N^NuNV�� n�Jg|��4/.� Hh�6a��N^NuNV�� n�Jg/.� Hh�:a��N^NuNV�� n�Jg(�4I`BN^NuNV�� n�Jg h� (�WI`BN^NuNV�� n�Jg h�Jg J�VID`BN^NuNV�� n�BJg (�> @N^NuHTAnchor_setTitle: New title is NULL! �Old title was "%s". �Old title was NULL. ��NV��/ / &n� .� Jg��Jg</�E�>/ a�� RJg�� k�>1�S� ��b� �RI k�>J1�f`pJ�A gHzNaԐ/aGPO +�>g4J�A g/�HzQal/aG|POXO +�>g(/�a�4B�>`J�A gHz4a:/aGJ$n&nN^NuNV��/ / &n�Jg:/.� E�>/ a��J RJg" k�>1�S� ��b� �RI k�>J1�f$n&nN^NuNV�� n�BJg (�( @N^NuNV�� n�Jg/.� Hh�(a��`N^NuNV�� n�BJg (�B @N^NuNV�� n�Jg/.� Hh�Ba��*N^NuNV�� n�BJg (�F @N^NuNV��/ / &n�Jg:/.� E�F/ a�� RJg" k�F1�S� ��b� �RI k�FJ1�f$n&nN^NuNV�� n�BJg (�^ @N^NuNV�� n�BJg (�p @N^NuNV�� n�BJg (�h @N^NuNV�� n�BJg (� @N^NuNV�� n�BJg (� @N^NuNV�� n�BJg (� @N^NuNV�� n�Jg(�YI`BN^NuNV�� n�BJg (�t @N^NuNV�� n�BJg (�| @N^NuNV�� n�BJg (� @N^NuNV��"n� n� JgJgJfB`/Hi�a��pN^NuNV�� n�BJg (� @N^NuNV��"n� n� JgJgJfB`/Hi�a��XpN^NuLinking anchor %p to anchor %p �HTAnchor_link�NV��H 8&n�(n� $.�JgJfB`��J�A g/ / Hza*/aG:POPOJf&'B�`JHx�Hx�a�$HPOJfHzHzaZPO$%B�J�f a�� 'H�/ /+�a��PO l� J�fa��"l� #H�/ l� /(�a��\pLN^NuNV�� n� P N^NuNV�� n�".� �f P`( (�g @Jg h�Jg"PJg �f Q` N^NuHTAnchor_makeMainLink�NV��H�8&n�(n� Jg/ /+�a�� fPOJ�fB`RHx�Hx�a�$HPOJfHzHzaYPO$%k��/ /+�a��&'l��POJg/ a�pL�N^NuNV��/ $n�J�Jf a��%H�J j�J $nN^NuNV�� n� h�N N^NuNV�� n�!n� �NN^NuNV�� n� h�R N^NuNV�� n�Jg/.� Hh�Ra�� N^NuHTAnchor_getUCInfoStage�NV��H 8&n�(n� Jg��J�f��$9�@rHx�Hx�a�$HPOJfHzHz}aXPOB!�  r!�(Rrl +�0g/�a)x$�l$9�@vl$9�@r  @�@[%X�%X� %X�%X�%X�%X�%X� %P�$r$%B�'J�Jf` A�"k�A LN^NuNV��/ / $n�&n� Jg&J�f/ / a�� j�G� J�o 0`p$n&nN^NuNV��H08&n�$.� $n�&.�JgR/ / a�(H k�E� 瀶�m6!� k�!m "@�@[ L `r( L` L N^NuNV��/ "n�$n�Jg i�Jf` E� !�� i�!�  i�PH $nN^NuNV��H<<(n�&.� *n�$.�Jgx/ / EN*// N$Hxf l�G� $0�Jft l�&CG<� "�灴�m4!� l�K� !g"J&EX" E""""""" J` L<<N^NuHTStyleNew�../../../WWW/Library/Implementation/HTStyle.c��NV��/Hx�Ha�$XOfHzHzaV$POHx�HB/aG B $.N^NuNV��/ /$.�a$H/Hj�a�� J $.$nN^NuNV��/ $n� *�g/�a�B�XO *�g/�a�B�XOJg/ a� $nN^NuStyleSheet: No style named `%s' ��NV��/ / n�$.� $h�Jg//*�aGHPOJf J`$$RJfJ�A g/Hza(/aG8 $.$nN^NuNV��/ $n� n� B *�f%H�`"@Jg"QJf" J $nN^NuNV��/ / &n�$n� +�f'R� K` K` @Jg "Pg IJf $n&nN^NuHTStyleSheetNew�NV��/Hx�a� $XOfHzHzaT^POHx�B/aG B $.N^NuNV��/ $n�` %P�/a�RXO j�JfJg/ a� $nN^NuHTList_new�../../../WWW/Library/Implementation/HTList.c�NV��/ Hx�Hx�a�$HPOJfHzHzaSBB� J $nN^NuNV��/ $n�`$j�Jg /�a�\XO f$nN^NuNV��/ $n�Jg( j�Jg "h�JgB� )�#j��%I�"@Jf J $nN^NuHTList: Trying to append list %p to a nonexisting list �NV��/ n�$n� "HJf J�A g/ Hza/aGڑ`$Jg J�gJ�g "i�J�f#j��B� $nN^NuHTList_addObject�HTList: Trying to add object %p to a nonexisting list �NV��H 0&n�$.� Jg2Hx�Hx�a�*$HPOJfHzHzaR$%k��'J�`J�A g/Hzwa/aGL N^NuNV�� .� n�JgJgJ�g h�J�f/�/a�jN^NuHTList: Treating negative object position %d as %d. �HTList_addObjectAt�NV��H00&.� .�$.�$@f J�A g��/Hza6/aGF`zJl$J�A gB/�Hzla/aG POPO&B`<Jf4Hx�Hx�a�$HPOJfHzmHzaP$%B�Jg'J�`&BSJ$+�fJm// a�lL N^NuNV�� .� n�Jg*Jg&J�g "H h�f#h��Jg/a� Tp`BN^NuNV��/ n� .� Jg0Jm,$H` Jf%h��$HJg/a�  R`$HS h�Jfؑ $nN^NuNV��/"n�Jg i�Jg$#h��/a� B` $.N^NuNV��/ n�Jg(J�g""H h�J�f$B�Jg/a� B` $.N^NuNV�� n�BJg `R h�JfN^NuNV��".� n�BJg`g R h�JfpN^NuNV�� n� .� JgJl ` P`JgS h�Jf N^Nu��2.14��NV��/ / $n�&n� Jg*gI/�I/a"POJfRJRKJfJgp`pJfB$n&nN^NuNV��H00$.�&.�$B&n� ЃfB`,gf II`I/I/�a!POJfRJRK`L N^NuNV��H08$n�&n� JgVBI�AUJgB�4��8�g/a�pXO$�`B�B4���g /�a�RXO fRJRKJfJgp`pJfBL N^NuNV��H<8(.�*.�&D$n� BI�AU ЅfB`PgJf II`>�4��8�g/a�XO$�`B�B4���g /�a�XO fRKRJ`L<N^NuHTSACopy�../../../WWW/Library/Implementation/HTString.c�NV��/ /$n�$.� gJ gRJg /�a� �BXO/aGR/�a�f$POfHzHzaLPO//aG` g /�a�B R $.$nN^NuHTSACat�NV��H�<(n�&n� Jg|Jgx grJg</�EG!N*@/ NHu/a� (POPOfHzHzaLlPO/ / `,/ aGbR/�a�(POfHzHzaL<PO/ /aG2 T L<�N^NuNV��/ $n�"RJg � bRIJff$`H ��"f(A�"HJg6 ��"g( ��\fJ)�gRIRIJg` IJg � cRIJfJgB$ $nN^Nu ;,=�<"�(�NVH?<*n�(.� $.�..�$UBJg��Jg��Jf(<� .Jf$<� . BHx� /IG!NPOJfHx� /NPOJf<�Hx�(/IG!NPOJVD�@B.J�f"Hx�(/NPOJfJf|�` �� b RJgJgJf *JgD"GB`>IG!Jg(Jf � cI//aGPOJgRJJff*Jg"G`� ��(f��J.fJ.g��BJ.g^JfZG�`T ��)fSJoJ ��(fR`, ��"f&RJJg4 ��"g ��\fJ*�gRJRJJfJg �\fJ*�gRJRJJfJ.f�RJgRJJg�0`~I//aGPOJg�� ��<gn ��:g"`& ��[g ��{g`<�>`<�]`<�}`<�;`JfG�$K`�g ��\fJ*�gRJRJJfJg��RJg��I/�/NPOJfI//NPOJf��I//NPOJV�D`�rJf&JJgNJf � c&I//NPOJfI//NPOJfRJJfgI/�/aGPOJg<�`� �(f(J.g"*/Hz<B/ a�6B UJgJgRH*`Jg"GJgB* K L<N^NuHTAlloc�NV��/$.� .� Jg/�/a�$PO` /�a�$XOJfHzHzaH\ B $.N^Nu%d�unknown format character '%c' in %s �NV'H?<*.�,.�"n�-Q-Eg*EJf`�/aG$@RJXO$9�A gC� Ѐ�A cK� Ѐ#�A /�/a�$#�A PO 9�A g ����A b#����A Hx�/�a�#�A POJf�-J/ B`*/.aGpR-@� XOc�$�-J/ /.a�-HPO`�*E �%f�B.<�A �]BB6|B8| y�A �%2|�-IR*Eg�R y�A ".�R�I-AA�AU0��gF"AAJfJgvrfJlI� I �`�rf�JlG� G �`� ��*fV"F QK�"(Jfvrf(D`rf&D/Hz y�A "nHpaG"/9�A aG:-@POPO`�vg�R:|�-M�Ir3e�0; N����h�z�h��z����h�z�h��z���z�zB"EI-A`��rlgrZ"F QK�"(4|�i`��"F QK�"U�4|�f`��"F QK�"(4|�c`��"F QK�".Jl /aG.&@XO4|�s`j"F QK�".4|�p`X"F QK�".`HJ�A g@/."EI/Hza/aGPOPO` ��.fv` ��%f :|�-M4|�%R"EgJg� y�A *nB5�Jo@rfgmr%g2rcg,`$rigrpg `A� o(H To (@`o(K 9�A n&A�A� #�A /�/9�A a�#�A POrfgmrcg`&rif /`'u�/9�A /9�A aGPOPO`//9�A /9�A aGPOXO/9�A aG"n� EXOeE� -@/�/.a�-HPO/9�A ".*n� Hu�aG/9�A aG~Ѯ� POXO`8 n� THe���/./.a�-HPO*n"n� �RR� "EJf�".*n� B5�J�g"n�" n L<. N^NuNV/ $n�BC�-IJg"g /aGXOHn/.� /�/ a� $nN^NuNVC�-IHn/.� B/.�a�z N^Nu\&#$^*?(){}<>"';`|�HTQuoteParameter�NV��H0<*n�/ aGj(@BXOJg.E�AU5(�I/HzaG4POJf2�8�gRKRbA�Hpa�x$HXOJfHzHzaBBJg�'pBcT5(� �'f(�'�R�"�R�'�R�"�R�'�` �\f�\�R�\�`�RRbJg�'�RB2� J L< N^NuNV�� n�BJg �%f (�s�fRRHJfN^NuNV�� n�".� og ��%f (�s�fSRHRHJn N^NuPARAM-EXP:%s �NV��H08(n�&n�&.�Jo��Hk/.� a$H$ POrmp gl/�a�BXO`^ �%fV *�s�fNg" g /�aGXO// a� TB2�PO// a�POJ�A g/Hzfa/aG`RJJfL N^Nu�PARAM-ADD:%s ��NV��H88(n�&n�(.�Jo��Hk/.� a�$H& POrm g /�a��BXOJf��(<� 9F`~ �%fv *�s�fng*$ g/�aGXO$B`$B// a� TB2�PO/a�V$// a�POXOJg /a�XOJ�A g/Hz7a/aG`RJJf�~LN^NuPARAM-END:%s �NV��H0 $n�&.� $.�/a�XOo$�//a�POJg // a�zPOJ�A g/Hza"/aG2L N^Nu��HTAddRule�../../../WWW/Library/Implementation/HTRules.c�Rule: For `%s' op %d `%s'�Rule: For `%s' op %d�(null)� %s %s � �NVH>0&.�(.� $.�*.�,.�BHx�Hx�a�l&HPOJfHzPHzVa>RPOJgB/Hna'n� PO`B� Jg/Hk�E� ,pN/Hk�NPOPO/Hna'n�'C�POJg&J�A g@///Hza/aG�`"J�A g//Hza/aGPOPOJg*J�A g< f <� ; /�/Hza/aG`J�A gHzal/aG|B y�A Jg `#�A #�A BL |N^NuNV��/ J�A gl$y�A #�A *�g/�a�B�XO *� g/�a�B� XO *�g/�a�B�XO *�g/�a�B�XOJg/ a�XO`B�A $nN^Nuif�unless�....... rule ignored, unrecognized `%s'! �redirected�userspec�....... rule ignored, unrecognized `%s %s'! ��NV��H 0$n� *�fp`��Hzp/�GG!NPOJg2Hz_/*�NPOJg"J�A g��/*�HzHa/aG`hHz^/*�GG!NPOJfJ�@^�D`HHzE/*�NPOJf9�@ #`0J�A g$ *�f <� ; /�/*�Hza/aGB` Hz/*�aGbJg JWID`IL N^NuDEFAULT�NULL!!�rule, setup�Protect�DefProt�HTRule: `%s' matched %s %s: `%s' �show rule message:�Rule: %s�%s�Rule alert:�HTRule: Mark for redirection permitted �NoProxy=�HTRule: Pass `%s' �For `%s' using `%s' �%.*s%.*s%s�HTRule: ...and pass `%s' �HTRule: ...and redirect to `%s' �HTRule: ...and redirect like 301 to `%s' �none�For `%s' will not use proxy �For `%s' proxy server ignored: %s �Proxied=�HTRule: proxy server found: %s �HTRule: *** FAIL `%s' �NVH<<BBBB/.�Hna$a�Hh&9�A POg�<"C&i�B*nJgg fRKRMJf ��*f2/ EG!N$�I�/ NPOk�/ Hu(�aGPOJf�`f�/a�XOJ�g�"C )�re�0; N�t|t��((�(4||BBJ�A gT"C )� f <� >pr�f <� >h/�HzC <� >r"C�f <� >/�/.Hz?aV/aGf�"C )� g,/�Hna-nG/ E� -N(H/ N$POPOr"C�f// /.a�FP`// /.a�E POXO .g�/�a�BXO`�HzaǶ/."C )� f <� >/�a:POXO`�HzaNJXO"C$)� f$<� >r �f$<� >Hx�%/aGfPOJg/./Hna$.POXO"C )�rgerg`@r g r g&`2/a8XO`&/a:XO`/a6XO`/Hz(a7LPO .g�/�a�BXO`�zJ�A g�Hza/aGPO`�"CJ� ffJg>BHzE/ a`/./ aPOPO .g/�a�bBXO-nJ�A g�Z/.Hza\/aGl`�@f>J�A g "C/)� /.Hza./aG>POPO"C/)� HnaPO`��Hx�*"C/)� aGPOJglBHh�/ /"C/)� � /HzcHna�J�A g/./.Hz,a/aGPOPO .g/�a�zBXO-n`VB"C/)� Hna8POJ�A g/./.HzaZ/aGjPOPO .g/�a�"BXO-n"C )�rffJg>BHztE/ a/./ aHPOPO .g/�a�BXO-nJ�A g�/.Hzha/aG`�r f(J�A g/.HzZa/aG۶#�@`6r f�pJ�A g/.HzKav/aGۆ#�@��@D�D��@`�f"C )� g:Hz9/�aPOJf(J�A g/.Hz a/aG,POXOx`��Jg8J�A g��"C )� f <� ; /�/.Hza/aGPOPO`��BHzE/ a|"C/)� / G� ,N/./ N�J�A g&"C )� f <� ; /�Hza|/aGڌPOXO .g /�a�DB n`pJ�A g/.HzaB/aGRPOXO .g�/�a�B`�"C&f�Jf n`$BHz\E/ a/./ a0 n L<<N^Nudefprot�protect�Insufficient operands:�HTRule: %s %s �suffix�%f�binary�presentation�%f%f%f%d�htbin�bindir�search�map�pass�fail�redirect�redirectperm�redirecttemp�permitredirection�useproxy�alert�alwaysalert�progress�usermsg�infomsg�Bad rule�HTRule: %s '%s' �301�permanent�302�303�temp�seeother�Rule: Ignoring `%s' in Redirect �userspecified��NVH?<,.�BBB/Hna$Hx�#/.aGJPOPOJgB-nE/ K� -N$XOg�/ N*HzJ/G� +8NPOXOJgHz</NPOJf(.`/ N(XOJf/.Hz Hz3`�Hz:/E� +8NPOJf^Hna$XO .gHnHz/�a�]fPOXO`B�\2Jo.D�'t�B f <� G/�//a0�`�*Hz/NPOJf�� .g"HnHnHnHnHz/�a�\�`BB~l"./~�\l.D�'t�~�\l.D�'t��\2Jo.D�'t�//a���$`�Hx�HzW/G� +NPOXOJgHx�HzC/NPOXOJf /Hy�A `Hx�Hz,/NPOXOJf/Hy�A aDPO`�6Hz/NPOJg�*Hz/NPOJg�Hz/NPOJg��Hz/NPOJg��Hx� Hz/NPOXOJg��Hz/NPOJg��Hz/NPOJg��Hz/NPOJg��Hz/NPOJgzHz/NPOJgfHz/NPOJgRHz/NPOJg>Hz/NPOJg*Hz/NPOJgHz/NPOJfR4|�`n4|�`h4|�`b4|�`\4|�`V4|� `P4|� `J4|�`D4|� `>4|� `84|� `24|�`,4|�`&4|�Jf/HzDHzIHy�AxaG>POPO`�A~ e�0;N��^�0�bbbbb�^�^��^(DJg�Jg�B`� Jg*Hz /G� +8NPOJgHz/NPOJf(DB`��Hna(HXO~ f��Hz7/K� +8NPOJf��Jg�Hz/ NPOJg��Hz/ NPOJg��Hz~/GG!NPOJgHzn/NPOJf4|� `XHzd/NPOJgJHzZ/NPOJg<HzP/NPOJg.HzG/NPOJg J�A g/Hz8a/aGPOXO*( Hna(HXOJg��Jg��Hna&XO`vB`rG/ K� -N(HXOJg Jg/ N&XOJgL Hx�%/�aGjPOJg8(�g ��%f T`Hx�%Hh�aGDPOJg(�g ��%g�?`JgLJg"CJgHzu/ aݦPOJfIc``Jg&Jg"CJgHzL/ a݀POJfI:`:JfJg��/HzHzHy�AxaGPOPO .g /�a�Bp`|JgR/GG!N/�Hz/K� +NPOPOJf&<� =2`(/NXO~d/N/�Hz/NPOPOJf&<� ==// /// a�� .g /�a�BBL<N^Nur�HTRules: Can't open rules file %s ��NV/ /$n�Hz/ aG$POf J�A g/ Hza/aGp`.E/Hx/ aGѴPOXOJg / a�"XO`/aG|B$.$nN^Nu��HTSetPresentation�../../../WWW/Library/Implementation/HTFormat.c�www/present�*��NV��H 0$.�Hx� a�&HXOJfHzHza*PO/E� N&HzN'H�'|�^�.T��+d��.T��+d��.T�� +d��'n�(�B� /.� Hk� atPOPOJ�A f a#�A Hz[/aGъPOJf 9�A g/�a�ZB�A #�A `/ /9�A aL N^NuHTSetConversion�NV��/ / Hx� a�&HXOJfHzHza)PO/.�E� N&/.� N'H�'n��B� 'n��'n��'n��'n� �B� POJ�A f a#�A / /9�A ar$n&nN^NuNV��#��A <�A#�A#�AN^NuHTFormat: Interrupted in HTGetCharacter �HTFormat: File read error %d ��NV��B�A "9�A̲�Ae��Hx�Hy�A/9�AaPOXOJnPfp`| f$J�A gHzha/aGr#�A `J�A g/�Hzka/aG`#�A�A�A#�A y�AR�A �� g�X���N^NuHTFormat: comparing %s and %s for half match �NV��H0 $.�&.� Hx�//aG.$HPOJgD *�*�f<J�A g//Hza/aG"POPO JHh//aG"�pJgBL N^NuHTFormat: Looking up presentation for %s to %s �FindPresentation: found exact match: %s �StreamStack: found strong wildcard match: %s �StreamStack: found strong subtype wildcard match: %s �www/source�StreamStack: found weak wildcard match: %s �NVH?<*n�&n� (n�BJ�A g/+�/-�Hza/aGPOPO/9�A a-@BBBBBXOo�,//9�A a($H RPOfb�f$J�A g/-�HzaZ/aGj J`� Jg��JfHzaJ$XO�fbJf, J�A gT R/(�Hz`6Jg��/-�/(�a�POJg0�f*Jf* J�A g R/(�Hza/aGPOXOHzaXOfN�f*Jf. J�A g:/+�Hza/aG˪POXO`JfJfHzEa$XO�f( Rm� EJf FJf GJf DJf`"L""""""""()K� L L<N^NuHTFormat: Constructing stream stack for %s to %s �StreamStack: Using %s �StreamStack: found exact match: %s �StreamStack: Returning "%s" �StreamStack: Returning *unknown* stream! �StreamStack: Returning NULL! �NVH 8(n�$n� $.�J�A g/*�/,�Hza"/aG2POPOf$B`nG/ / / a�$HPOXOJgTfJ�A g2 n/(�Hz`J�A g R/(�Hza/aGPOXO//.�/ j�N$HPOXO`J�A gtJg@ RJg g/�Hza~/aGɎ`PJgJ�A gDHza^/aGn`0J�A g(HzG�N/aGPPOJ�A g N/aG J LN^NuNV��/B/.� /.�a�$POXOg//9�A aH//9�A aϚ$.N^NuHTFormat: Evaluating stream stack for %s worth %.3f to %s ��NV��' H<8&n�$n� .E��*.�Hz=I� N(XOJ�A g"/*�'u�/+�HzaN/aG^�HzNXOgf�\`��/9�A aр&�BXOod//9�A aѮPOfJ (�gf>�(D� 9�A �D��]� 8�(D��@'(D"��D$����`Rn<D�IL<.0N^NuNV��/ /J9�@4gTa$@й�CGN$�S�@6o: y�@ JoA$al `ama#�@6/ a$.$nN^NuNV��B9�@4N^NuData transfer interrupted.�NETREAD�Unexpected server disconnect.�HTCopy: Unexpected server disconnect. Treating as completed. �Unexpected read error.�message/x-http-redirection�Data transfer complete�NVH<0$n�*.� &n� S-X-X-X-X-X-PBBBa"POJ9�@7gB9�@7B/ nNt`�ra$Jf(Hx�Hy�A/a&�POXOn��g�* f2��@dHza!B/ nNPOXOtJg�$<`� 9G ,rMg rJgr fBJnt`��Hzqa�Hzoa.POJ�A g��HzwaH/aGXPO`��Hz9a�HzaPOJg/aGt7FXO`��B/ nNt`xBJg *�hgHzn/�aGPOJf<�/Hy�A/ nN؃POXOJfBJg *�/�/a!8POa�`���@dHz3a ~/aG\t7FPOa�\ L <N^NuHTFormat: Read error, read returns %d ��NVH00$n�&n� S-X-X-X-X-X-PBBBa PO/ Hx�Hx�Hy�AaG$�POPOfB*� �� ft7F`��J�A gr €/Hz`a/aGPOXOtJgjt1F`d/Hy�A/ nNւB/a "�J9�@4g y�@ $�ga�aJg�^��@dHzNaJXOtJg$<a�( L N^NuNV/ $n� R-X-X-X-X-X-P/.� a�nXOa�rgI/�/ nNPO`$nN^NuSorry, no known way of converting %s to %s.�HTFormat: %s �NVH08(n�&n� $.�&.�/// / a�F$HPOPOJf~BJ9�@7g B9�@7p`��/+�/,�HzvHnaآPOPOJ�A g/.HzaB/aGRPOXO/.Hx/aw $�POXO .gR/�a�B`D R-X-X-X-X-X-P/ B/.�/a�$�POPOrg g/ nN L N^NuHTFormat(in HTParseFile): %s �NVH 8(n�&n� $.�/.�// / a�.$HPOPOJf��BJ9�@7g B9�@7p`��/+�/,�Hz\Hna׈POPOJ�A g/.Hzta(/aG8POXO/.Hx/av$�POXO .g /�a�B `t R-X-X-X-X-X-P/ /.�a�$�POrg f B/ nN`/ nNrfpF�` g Jo ���gp1F�`p7F�LN^NuNV��/ /$n�.�J*�g2 � f j�"PHx� / i� NB*�`4 j�"PHx� / i� NPO � WD�@�f j�"PI// i� N$.$nN^NuNV��/ /$.�$n� JgI/�/a�nPOJf$.$nN^NuNV��H0 &.�$n� Ю�c$�I//a�4PObL N^NuNV��/ $n� j�"P/ i�NXOJg/ a�P$nN^NuNV��/ $n� j�"P/.� / i�NPOJg/ a�$nN^NuNetToText�NV��/ Hx� a�x$HXOJfHzHza$�A B*�%n�� J $nN^NuNV����@7N^NuNV�� n� Jg Jg��@7N^NuNV��J�gJ� g��@7N^NuNV��N^NuNV��N^Nu� b:� b� b� a� a� aErrorStream�ErrorStream. Created �NV��J�A gHza@/aGPA�A � b" N^NuNV��/ $n�Jg0g, ��"f&/ aG 2�"fB2BJg JRJf$nN^NuHTMIME: Extended MIME Content-Type is %s �charset�x-transparent�iso-8859-�windows-�cp12�cp-12�ISO-8859�0�www/debug�HTTP: 'Location:' is zero-length! �Got redirection with a bad Location header.�HTTP: Failed to pick up location. �Got redirection with no Location header.�HTMIME: MIME Content-Type is '%s', converting to '%s' �HTMIME: MIME Content-Type is '%s', �www/compressed� Treating as '%s'. Converting to '%s' �HTMIME: Can't translate! ** ��NVH><(n�Hx�; lB/(�EG!NPOJg� BBJ�A g lB/(�Hza/aGPOXO lB/(�Hnat/.aHx�;/.N&H�Jg�BHz/ a�DPOJg�p^H`RH �� g ��=g ��"g/Hna$nPO` � cRJg �"g � ��bB$n/ a�$�/9�@U/(<�ej*DNPOXOJ�g<<�B/.a)HB/ z0ڬ"/aƤHx�B//,"a�`NJlJ$9�@vl$9�@r/9�@U/*DNPOJ�g*<�B/.a)HBHx�B//,"a�Jg�B/,"(<� *DN&HHx�Hx�/9�@U/,"&<� !*CN$H�JfHx�/,"*DN$HPOHz~/+�(<G!*DNPOJf,��@Hx�BHx�/,"aXO./,"*CNPOPOHz:/*�*DNPOJf,��@Hx�Hx�B/,"aXO./,"*CNPOPOz�g&B�@+���f�t�@Uf�j��@`�^z�f�T/*�/+�a:PO`�@BHx� Hz/ aGbPOXOJfB*� A�AU0��g<�BJfDHx�Hz/ $<G!*BNPOXOJg(Hx�Hzy/ NPOXOJgHx�Hzj/ NPOXOJf<�BJgDHzV 9�@U&<�@Z*C/5 �,<� *FNPOJfHz 9�@U*C/5 �*FNPOJg<�JgB/.a)HBXOJg"G� JgBA�AU0��gRKJfBJg/ z0ڬ"/a��@POJf l" (�0` /�aXO .g /�a�B`B/.a)HBXO .g/�a�BXO l"J(�ffh (�gbHz]/�aGPOJgF l"J�g*Hx�/(�E�4N$�Hx� l"/(�NPOPOm`B/(�aPOJn l"|��f lB/(�zhڬ"/a"PO ,.fJ2g@ l"/(�/,2/�aHPOXO ,.g/�a�B.XO ,2g/�a�B2XOJ,�g�� l6Jg.Jg*#�@B6Hz{aXObfJ&gx|��`pB9�@J6g(J�A gHzQa/aGPOHz`arXOJ�A gHzxa/aG嶞PO ,6g/�a�XB6` Hzsa6XOJ,�f�J,�f��J>f2J�A g�� lb/(� lB/(�Hz`a*/aG:POPO`vJ�A g lB/(�Hzoa/aGPOXOHz}a"H)IBXOJ�A g" lb/(�/)�Hzfa/aGPOPO ,>g/�a�ʎB>XO/,"/,&/,b/,BaD)HFPOPOf"J�A gHzCat/aG嵄)l&Fg lF"PAJ B�`zD)E�BL<|N^NuHTMIME: PICKED UP Accept-Ranges: '%s' �HTMIME: PICKED UP Age: '%s' �HTMIME: PICKED UP Allow: '%s' �HTMIME: PICKED UP Alternates: '%s' �HTMIME: PICKED UP Cache-Control: '%s' �no-cache�max-age�HTMIME: PICKED UP Cookie: '%s' �HTMIME: PICKED UP Connection: '%s' �HTMIME: PICKED UP Content-Base: '%s' �HTMIME: PICKED UP Content-Disposition: '%s' �filename�HTMIME: PICKED UP Content-Encoding: '%s' �identity�8bit�7bit�binary� Ignoring it! �HTMIME: PICKED UP Content-Features: '%s' �HTMIME: PICKED UP Content-Language: '%s' �HTMIME: PICKED UP Content-Length: '%s' � Converted to integer: '%d' �HTMIME: PICKED UP Content-Location: '%s' �HTMIME: PICKED UP Content-MD5: '%s' �HTMIME: PICKED UP Content-Range: '%s' �HTMIME: PICKED UP Content-Transfer-Encoding: '%s' �HTMIME: PICKED UP Content-Type: '%s' �HTMIME: PICKED UP Date: '%s' �HTMIME: PICKED UP ETag: %s �HTMIME: PICKED UP Expires: '%s' �HTMIME: PICKED UP Keep-Alive: '%s' �HTMIME: PICKED UP Last-Modified: '%s' �HTMIME: PICKED UP Link: '%s' �HTMIME: PICKED UP Location: '%s' �HTMIME: *** Ignoring Location! �HTMIME: PICKED UP Pragma: '%s' �HTMIME: PICKED UP Proxy-Authenticate: '%s' �HTMIME: PICKED UP Public: '%s' �HTMIME: PICKED UP Retry-After: '%s' �HTMIME: PICKED UP Safe: '%s' �YES�TRUE�NO�FALSE�HTMIME: PICKED UP Server: '%s' �HTMIME: PICKED UP Set-Cookie: '%s' �, �HTMIME: PICKED UP Set-Cookie2: '%s' �HTMIME: PICKED UP Title: '%s' �HTMIME: PICKED UP Transfer-Encoding: '%s' �HTMIME: PICKED UP Upgrade: '%s' �HTMIME: PICKED UP URI: '%s' �HTMIME: PICKED UP Vary: '%s' �HTMIME: PICKED UP Via: '%s' �HTMIME: PICKED UP Warning: '%s' �HTMIME: PICKED UP WWW-Authenticate: '%s' ��NV��H0<(n� l�B$l�A�"d "� fBe ,�Wr:e� 0; N��v� ��� �� � �, �L � | �.~ �R �>^ � �  4 T � t �  � R �  $ � D d � � E�"/ a�XOJ�A g� / Hz`� \E�"/ a�XOJ�A g� d/ Hz`� <E�"/ a�XOJ�A g� D/ Hz`� E�"/ a�XOJ�A g� $/ Hz`� E�"/ a�`XOJ�A g/ Hza|n/aG~POXOJg� Jg� / aJ/ rbҬ"/a�"JPOXOHz/ a�6POJg,PHJg � bRHJfg ��;f l"|��f`"H` l" (��fg� xC�"BHze/ a�6DPOJg� ^^HJg � bRHJf �=f>` � bRHJfE�AU2�(�g "HBRH2��f �0f Rg� "H`E�"/ a�JXOJ�A g� / Hz`� E�"/ a�*XOJ�A g� / Hz`� E�"/ a� XOJ�A g/ Hza{/aG(POXOJg� Jg� / rt`�.E�"/ a�XOJ�A g/ Hzaz/aGPOXOJg� RJg� L/ rxҬ"/ar l"$h�xPOJg� ,Hx�Hz/ aPOXOJgRJJfJg� PJJg� � �� c ��=fRJJfJg� � bRJJfJg�/ r^Ҭ"/a l" h�^PO �"f8Hx�"Hh�aG$HPOJf l" (�^g�/�`BB*� l"/(�^a�XO l"$h�^Jg � cRJJfB l" h�^Jf�TJg�N/a� l"B�^`�:E�"/ a�XOJ�A g/ Hzay/aG媞POXOJg�Jg�Hz/ aPOJg�/ aV/ rpҬ"/K� ,pNPOXO ,>g/�a�B>XOHz/ GG!NPOJgHz{/ NPOJgHzr/ NPOJfJ�A g�Hza`� / Hl>N`�nE�"/ a�XOJ�A g�X/ HzS`�0E�"/ a�XOJ�A g/ Hz_ax/aG婲POXOJg�Jg�/ a~/ rl`��E�"/ a�LXOJ�A g/ HzAaxZ/aGjPOXOJg�Jg�/ aG l"!@� l"XOJ�lB�J�A g� l"/(�Hz`�vE�"/ a�XOJ�A g/ Hzaw/aGPOXOJg�bJg�\/ r|Ҭ"/a`�HE�"/ a�XOJ�A g/ Hzaw/aG娬POXOJg�Jg�/ (l"�`�:E�"/ a�HXOJ�A g�/ Hz`�E�"/ a�(XOJ�A g/ Hzaw6/aGFPOXOJg�Jg�/ a/ a )H:`�E�"/ a�XOJ�A g/ Hzav/aGPOXOJg�`Jg�ZBB2" �� g( ��"g"G8"R�A�AU0��(�g /a�XORJJ2"fB48"Hl�"a)HB`�E�"/ a�JXOJ�A g/ HzZavX/aGhPOXOJg�Jg�/ (l"�`�J�A gHl�"Hz<av/aG,POXOA�"Jg�Jg�/(l"�`�E�"/ a�XOJ�A g/ Hzau/aGPOXOJg�LJg�F/ (l"�`�pE�"/ a�~XOJ�A g�"/ Hz`�E�"/ a�^XOJ�A g/ Hzaul/aG|POXOJg�Jg�/ (l"�`� E�"/ a�XOJ�A g�/ Hz`�E�"/ a�XOJ�A g/ Hzau/aGPOXOJ,�gJ6f/ Hl6a`�jJ�A g�`Hzat/aG`�JE�"/ a�XOJ�A g/ Hzat/aG奮POXOJg�Jg�Hz/ aGvJf��`�E�"/ a�BXOJ�A g�/ Hzv`�E�"/ a�"XOJ�A g�/ Hz`�E�"/ a�XOJ�A g�/ Hz`�~E�"/ a�XOJ�A g/ Hzas/aG�POXOJg�jJg�dHz/ G� +8NPOJgHzu/ NPOJf l"|��Y`�4Hz^/ NPOJgHzS/ NJf� l"B(�Y`� E�"/ a�RXOJ�A g/ Hz)as`/aGpPOXOJg�Jg�/ (l"�/ a`�G�"/ a�XOJ�A g/ Hzas/aG"POXOJ.f/ Hl.a`�|Hz$ ��.`NG�"/ a�XOJ�A g/ Hzar/aGPOXOJ2f/ Hl2af`�,Hz$ ��2/E� ,N/ /N`� E�"/ a�RXOJ�A g��/ Hz`��E�"/ a�2XOJ�A g��/ Hz`��E�"/ a�XOJ�A g��/ Hz`��E�"/ a�XOJ�A g��/ Hz`nE�"/ a�XOJ�A gx/ Hz`RE�"/ a�XOJ�A g\/ Hz`6E�"/ a�XOJ�A g@/ Hz`E�"/ a�XOJ�A g$/ Hzaq/aG增`p` l"|��fBL< N^NuHTMIME: Got 'A' at beginning of line, state now A �HTMIME: Got 'C' at beginning of line, state now C �ate:�HTMIME: Got 'D' at beginning of line, checking for 'ate:' �HTMIME: Got 'E' at beginning of line, state now E �eep-alive:�HTMIME: Got 'K' at beginning of line, checking for 'eep-alive:' �HTMIME: Got 'L' at beginning of line, state now L �HTMIME: Got 'P' at beginning of line, state now P �etry-after:�HTMIME: Got 'R' at beginning of line, checking for 'etry-after' �HTMIME: Got 'S' at beginning of line, state now S �HTMIME: Got 'T' at beginning of line, state now T �HTMIME: Got 'U' at beginning of line, state now U �HTMIME: Got 'V' at beginning of line, state now V �HTMIME: Got 'W' at beginning of line, state now W �cept-ranges:�HTMIME: Was A, found C, checking for 'cept-ranges:' �e:�HTMIME: Was A, found G, checking for 'e:' �HTMIME: Was A, found L, state now AL' �'g' or 'l'�HTMIME: Bad character `%c' found where `%s' expected �ow:�HTMIME: Was AL, found L, checking for 'ow:' �ernates:�HTMIME: Was AL, found T, checking for 'ernates:' �'l' or 't'�che-control:�HTMIME: Was C, found A, checking for 'che-control:' �HTMIME: Was C, found O, state now CO' �'a' or 'o'�HTMIME: Was CO, found N, state now CON �kie:�HTMIME: Was CO, found O, checking for 'kie:' �'n' or 'o'�ection:�HTMIME: Was CON, found N, checking for 'ection:' �ent-�HTMIME: Was CON, found T, checking for 'ent-' �'n' or 't'�ag:�HTMIME: Was E, found T, checking for 'ag:' �pires:�HTMIME: Was E, found X, checking for 'pires:' �'t' or 'x'�st-modified:�HTMIME: Was L, found A, checking for 'st-modified:' �nk:�HTMIME: Was L, found I, checking for 'nk:' �cation:�HTMIME: Was L, found O, checking for 'cation:' �'a', 'i' or 'o'�HTMIME: Was P, found R, state now PR' �blic:�HTMIME: Was P, found U, checking for 'blic:' �'r' or 'u'�gma:�HTMIME: Was PR, found A, checking for 'gma' �xy-authenticate:�HTMIME: Was PR, found O, checking for 'xy-authenticate' �fe:�HTMIME: Was S, found A, checking for 'fe:' �HTMIME: Was S, found E, state now SE' �'a' or 'e'�ver:�HTMIME: Was SE, found R, checking for 'ver' �-cookie�HTMIME: Was SE, found T, checking for '-cookie' �'r' or 't'�HTMIME: Was SET_COOKIE, found :, processing �:�HTMIME: Was SET_COOKIE, found 2, checking for ':' �':' or '2'�tle:�HTMIME: Was T, found I, checking for 'tle:' �ansfer-encoding:�HTMIME: Was T, found R, checking for 'ansfer-encoding' �'i' or 'r'�grade:�HTMIME: Was U, found P, checking for 'grade:' �i:�HTMIME: Was U, found R, checking for 'i:' �'p' or 'r'�ry:�HTMIME: Was V, found A, checking for 'ry:' �a:�HTMIME: Was V, found I, checking for 'a:' �'a' or 'i'�rning:�HTMIME: Was W, found A, checking for 'rning:' �w-authenticate:�HTMIME: Was W, found W, checking for 'w-authenticate:' �'a' or 'w'�HTMIME: in case CONTENT_ �ase:�HTMIME: Was CONTENT_, found B, checking for 'ase:' �isposition:�HTMIME: Was CONTENT_, found D, checking for 'isposition:' �ncoding:�HTMIME: Was CONTENT_, found E, checking for 'ncoding:' �eatures:�HTMIME: Was CONTENT_, found F, checking for 'eatures:' �HTMIME: Was CONTENT_, found L, state now CONTENT_L �d5:�HTMIME: Was CONTENT_, found M, checking for 'd5:' �ange:�HTMIME: Was CONTENT_, found R, checking for 'ange:' �HTMIME: Was CONTENT_, found T, state now CONTENT_T �HTMIME: Was CONTENT_, found nothing; bleah �HTMIME: in case CONTENT_L �nguage:�HTMIME: Was CONTENT_L, found A, checking for 'nguage:' �ngth:�HTMIME: Was CONTENT_L, found E, checking for 'ngth:' �HTMIME: Was CONTENT_L, found O, checking for 'cation:' �HTMIME: Was CONTENT_L, found nothing; bleah �HTMIME: in case CONTENT_T �HTMIME: Was CONTENT_T, found R, checking for 'ansfer-encoding:' �pe:�HTMIME: Was CONTENT_T, found Y, checking for 'pe:' �HTMIME: Was CONTENT_T, found nothing; bleah �HTMIME: *** Syntax error. (string too long) �NV��H00$n�.� *�g��J*�g � g�rDe�0; N���X:$  n X  6  .� � I//*F jVN`�p � g< � b6%j��r?�f�T"j�Jg�JA�"g�@ )� c�6<� `�r?�f/ a�XO|���Irme�0; N�>�� 2Jp&�� 2Jp&r%A�J�A g�Hz`� rr%A�J�A g� Hz-`� Z%|� ~�r%A� rB%A�J�A g� Hz?`� 4r%A�J�A g� Hzb`� %|� !�r %A� rB%A�J�A g� Hzz`� r!%A�J�A g� Hz`� r%%A�J�A g� hHz`� %|� �r*%A� rB%A�J�A g� BHz`� r+%A�J�A g� *Hz�`� r2%A�J�A g� Hz`� pr5%A�J�A g� Hz6`� Xr8%A�J�A g� HzQ`� @r;%A�J�A g� Hzl`� (B*�/ a� `� �Ir)e��0; N��T����z����������������������������T����z�����%|� �r%A� rB%A�J�A g� *Hz `� %|� a�r%A� rB%A�J�A g� Hz`� br%A�J�A g� Hz1`� JJ�A g� HzF`� �Tg>n �Lg`Z �lg �tg(`L%|� �r%A� rB%A�J�A g� HzG`� %|� (�r%A� rB%A�J�A g� pHzW`� J�A g� XHzw`�L �Og>n �Ag`L �ag �og(`>%|� n�r %A� rB%A�J�A g� HzK`� xr %A�J�A g� Hzh`� `J�A g� Hz}`� �Og0n �Ng`L �ng �og`>r %A�J�A g� HzR`� %|� �r %A� rB%A�J�A g� HzY`� J�A g� |Hzu`�p �Tg>n �Ng`Z �ng �tg(`L%|� H�r %A� rB%A�J�A g� >HzD`� %|� �r%A� rB%A�J�A g� HzU`� vJ�A g� �Hzr`� �Xg>n �Tg`Z �tg �xg(`L%|� �r%A� rB%A�J�A g� Hz=`� %|� �r%A� rB%A�J�A g� HzJ`�J�A g� Hzg`�x�Ir.e��0; N��^��������������������������������^��������������%|� 2�r"%A� rB%A�J�A g�Hz`�L%|� t�r#%A� rB%A�J�A g�Hz`�&%|� �r$%A� rB%A�J�A g�Hz`��J�A g�Hz"`�~ �Ug0n �Rg`L �rg �ug`>r&%A�J�A g�ZHz`�%|� �r)%A� rB%A�J�A g�4Hz`�J�A g�Hz`� �Og>n �Ag`Z �ag �og(`L%|� R�r'%A� rB%A�J�A g�Hz`�<%|� �r(%A� rB%A�J�A g�Hz`�J�A g�Hz3`� �Eg>n �Ag`L �ag �eg(`>%|� �r,%A� rB%A�J�A g�bHz`�r-%A�J�A g�JHz`�J�A g�2Hz`�& �Tg>n �Rg`Z �rg �tg(`L%|� 0�r.%A� rB%A�J�A g�Hz`�R%|� b�r/%A� rB%A�J�A g�Hz`�,J�A g�Hz `� �2g$ �:fDr0%A�r>%A�J�A g�Hz`�%|� �r1%A� rB%A�J�A g�lHz`�J�A g�THz`�H �Rg>n �Ig`Z �ig �rg(`L%|� �r3%A� rB%A�J�A g�Hz`�t%|� E�r4%A� rB%A�J�A g�Hz`�NJ�A g�Hz"`� �Rg>n �Pg`Z �pg �rg(`L%|� �r6%A� rB%A�J�A g�Hz`�%|� �r7%A� rB%A�J�A g�tHz`�J�A g�\Hz`�P �Ig>n �Ag`Z �ag �ig(`L%|� �r9%A� rB%A�J�A g�Hz`�|%|� 8�r:%A� rB%A�J�A g�Hz`�VJ�A g�Hz`�� �Wg>n �Ag`Z �ag �wg(`L%|� q�r<%A� rB%A�J�A g�Hz`��%|� �r=%A� rB%A�J�A g�|Hz`�J�A g�dHz`X j�IR�BA�AU0���g/�a�XOg`f j�Jf�(%j� �`�J�A g�&j�SK/ I/HzaVh/aGx`�J�A gHzaVJ/aGZPO�Ir2e�0; N��fz���zzzzz�zzzz<zbzzzzzzzzzzzzz�fz���zzzzz�zzzz<zb%|� �r%A� rB%A�J�A g�:Hz `�%|� M�r%A� rB%A�J�A g�Hz#`�r%|� �r%A� rB%A�J�A g�HzA`�L%|� �r%A� rB%A�J�A g�Hz\`�&r%A�J�A g�Hz|`�%|� J�r%A� rB%A�J�A g�Hz`�%|� �r%A� rB%A�J�A g�dHz`�r%A�J�A g�LHz`�J�A g�4Hz`�J�A gHzaT/aG党PO�Ir.e��0; N��^��������������������������������^��������������%|� 7�r%A� rB%A�J�A g�Hzw`��%|� w�r%A� rB%A�J�A g�\Hz`��%|� �r%A� rB%A�J�A g�6Hz`��J�A g�Hz`�J�A gHzaSt/aG億PO �Yg<n �Rg`f �rg �yg&`X%|� E�r%A� rB%A�J�A g��Hz`"%|� t�r%A� rB%A�J�A g��HzaS�/aG`��J�A gzHz`f%j��r>%A� � f %j��rA`Z � cXG�"%K�r?%A� � gA!"j�cR�`0 � f*%j��rA`J�A gHzaRz/aG僊r@%A�L N^NuHTMIME: %s ��NV��/ / &n�$n� +�f/ /+F kZN`:rDg4J�A g(/ HzaR/aG&POXO`I// a�RPOJf$n&nN^NuHTMIME: %.*s ��NV��H 0&n�$n� $.�J�f// /+F k^N`>J�A g/ /HzaQ/aG傪POPO Ђc$�I// a�PObL N^NuNV��/ $n�Jg@ *6g/�a�.B6XO *>g/�a�B>XO *Fg /� jNNXO/ a�$nN^NuNV��/ $n�JgD *6g/�a�B6XO *>g/�a�B>XO *Fg/.� /� jRNPO/ a�$nN^Nu� � J� � � ^� MIMEParser�HTMIMEConvert�../../../WWW/Library/Implementation/HTMIME.c�text/html�NV��H�8(n�$n� HxfHx�a�6&HPOJfHzHzaPO&� 'n�&'J"B*�Y k"B(�f k" (�bg/�a� k"B�bXO k" (�^g/�a� k"B�^XO k" (�0g/�a� k"B�0XO k" (�lg/�a�z k"B�lXO k" (�pg/�a�^ k"B�pXO k" (�tg/�a�B k"B�tXO k" (�xg/�a�& k"B�xXO k" (�|g/�a� k"B�|XO k" (�g/�a� k"B�XO k"B� k" (�g/�a� k"B�XO k" (�g/�a� k"B�XO k" (�g/�a� k"B�XO k" (�g/�a�v k"B�XO k" (�g/�a�Z k"B�XOBFr'A�Hzahl'HB'l�bB*B.B2B:B>B+�Hx�Hx�/9�@U/+"E� !NHx�Hx�/9�@U/+"N K L�N^NuNV��/.�/.� /.�a�Jg|��` N^NuNV��/ /$.�//.� /.�a�l$HPOXOJf`"|��Hz-agbf Jg|�� J $.$nN^NuNVH<0&n� E�Jg��B +�=�fv` v +�=�fvBm.x3(�I/Hy�A aG& POg`�A ڀ]RltA(�EQBBSdSrgSrgJgXKJf�vBHn�/.�aG~L <N^NuNV�H 0&n� E�Jgn ��=fT+�gJI/�Hy�A 2aG~ POg4�A 2�+�g&I/�Hy�A 2aG~` POg�A 2�VK`` ��_f� `RK`BHn�/.�aG~0L N^Nu=?ISO-2022-JP?B?�=?ISO-2022-JP?Q?�NV�H8<(.� B.�$DG�Jg��K� +I�Hx�Hz/ NPOXOBJfvHx�Hz/ NPOXOBJftJfJg��J�A DgAb �� g �� fSKSHcPJPJA�Jg ��?f *�=�gRJJf �?f^ *�=�fVTJBJg / / a�POJg / / a�nPOA�JgJfr#�A D` �� g �� gB�A DJf�BHn�/.�aG|L<N^NuNV�H00&.�&n� BHx�/ EG!NPOJfHx�$/ NPOJfg / /aG|p`~E�JgfJf> �$f4+� ��@g ��Bf$+�I/+�I/aTPOJg.t�` Jg �(f+� ��Jg ��BfB�JfHn�/aG|BL N^NuNV��/ $n�"n� Ar]e�r l�Ard��rtm��ArRe�60;N�����,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,",,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,,&Ar d(ArdAr dArd AreTB`RrlArdArdrZ`.rS`*rV`&Ardr8`ArdrQ` r `r3`rmp$nN^NuNV��/ / &y�A fJgjJg &k�Jg$SJgD g /�a�:BXO *�g/�a�(B�XO *�g/�a�B�XO/ a�XO`/9�A fa~B�A f$n&nN^NuNV�� y�A P N^NuNV��/.�Hy�A PaN^NuNNTPSERVER�HTNews: NNTPSERVER defined as `%s' �r�/usr/local/lib/rn/server�%s�HTNews: File %s defines news host as `%s' �news��NV�/ /HzxEG NXOJg@HzfN/Hy�A PaPOXOJ�A g��/9�A PHzIaG/aGx POXO`rHzUHzSaGw$POg^E�/ HzV/a�tPOXOrf8/ Hy�A PaPOJ�A g /9�A PHz Hz!aF/aGwPOPO/aGwtXOJ�A PfHz$Hy�A Pa:r#�Ap$.$nN^NuNNTP command to be sent: %s�HTNews: Unable to send command. Disconnecting. �NNTP Response: %s �%d�HTNews: Interrupted on read, closing socket %d �HTNews: EOF on read, closing socket %d �NVH8 $.�E�Agz/aGw&�XOJ�A g/HzaEt/aGvPOXO///9�AaGw$�POXOl6J�A gHz�aE>/aGvNPO/9�AaGux#�A `��a"� �� g�AfBB*J�A gHy�AHzaD/aGuPOXOHnHzHy�Aa� .`vxfB*J�A gJ�A g0/9�AHz`J�A g/9�AHzaD/aGuPOXO/9�AaGu8x#�AJ�A fp` B�A <LN^NuNV��H00&n�$n� g:Jg6BI�A�AU0�(�g/a�TXOg`f RKRJgJfJWIDL N^NuUsername for news host '%s':�AUTHINFO USER %.*s%c%c�Connection interrupted.�Connection closed ???�Change username?�Username:�Password for news host '%s':�AUTHINFO PASS %.*s%c%c�Change password?�NVH0<&.�˙̛BJ9�@ .f�jJg�d"CJg�\ 9�A fg0$@Jg $j�Jg&RJg&//aGtPOJf(k�*k�` ax#�A fB.tJfB/HzHnaB/.a؈(H� .g/�a�RBXOJg�Jg�Hx� Hx� / HxHzE�/ aGt$/ a�$@�JlZf��@dHzta�` HzaXOJg" +�g�PJg /�a�B�'L�`�8Jg�2/ `�&��fPJg" +�g�Jg /�a�B�'L�`�Hx� Hx�a�&HPOJg�p// a~H'L�`�P��}gzHy�Aa:SXOJoBHzaԐXOJ�g2Jg�gJg / a�XO/ Hza0(HPOJgJfJg�| +�g�^`�HJf�d��}f�jtJfD/HzHna,/.a׈*HPOPO .g/�a�BXOJg�*Jf/ `�Hx� Hx� / HxHz^E�/ aGrx/ a�$@�Jllf��@dHzaT` Hza.XOJg�� +�gJg/�a�$B�XO'L� +�g��Jg /�a�B�'M�`l��fnHy�AaXOJg8 +�fJg/�a�B�XO +�fJg/�a�B�XOJg / a�XOJg/ a� <��`���f��Jg< +�gJg/�a�bB�XO'L� +�gLJg /�a�DB�'M�`6Hx� Hx�a�N&HPOJg // a{'L�'M�/ /9�A fawJ <��`��Hy�AaXOJg�gJg/ a�֛XO`SJoHzaXOJ�f�Jg0 +�fJg/�a�B�XO +�g/�a�B�XOJg/ a�vBL< N^NuTrying to find name in: %s �NV��/ / /.�Hy�A ja{POJ�A g/9�A jHza>:/aGoJPOXOHx�(/9�A jGG!N$HPOJgHx�)/9�A jNPOJg dBHj�`>Hx�</9�A jGG!N$HPOJgHx�>/9�A jN POg RHdf/9�A ja $n&nN^NuTrying to find address in: %s ��NV��H�8/.�Hy�A naz.POJ�A g/9�A nHza=R/aGnbPOXOHx�</9�A nIG!N$HPOJg2Hx�>/ N&HPOJg"Hx�@/ NPOJgcBHj�aT`�6Hx�(/9�A nGG!N$HPOJgDHx�)/9�A nN&HPOJg0Hx�@/9�A naGnPOJgdcB/9�A na`��Hx�@/9�A naGnPOJgp"9�A ndfEG�d$BA�AU0��fBSJd 0��gg&���A�AU0��fBRKg �0��gB/ an`P$y�A nBA�AU0��gBRJ0��f&JBA�AU0��fBJg RK0��gB J L�N^NuNV/BtWD�Rtl-n�BHxHnHnB/9�A y�AN$.|N^NuNV/BBtgtf<�Rt l-n�-n� BHxHnHnHx�E/9�A y�AN$.N^NuNV/ ArTD�RIr l/.�HzE/ aGl-J-JBHxHnHnHx�P/9�A y�AN$nN^Nu%s%.*s��NV/ / &n� $K` �,gRJJ�g ��>g �� b/9�A XaGl|C XO ���b&A-H/9�A X/aGlN/ / /.aGlL`B/ / /9�A XHzxHnafPOPO.a�\/.�/9�A y�ANBB/9�A y�ANA .�gJg /�a�B$n&nN^NuNV��/ / n�Jgp � bRHJfg`$H �� g �,g RJg �� fJgRJB �<fHh�`//a�XOBHxBBHx�/9�A y�AN J�`$.$nN^NuNetwork Error: connection lost �Network Error: connection lost��NV��J�A g/9�AHza8/aGiPOXO/9�AaGiXOJ9�A dgHz/9�A ` y�A `"Hz/9�A y�ANHx� /9�A y�ANr#�AN^NuNV��H 0&n� �� g@ �� g:Hx�:/ EG!N$Hx� / N"HIA�AUB�gJg "RfpL N^Nu�Cannot open temporary file for news POST.�%c%c�.�From:�From: anonymous@nowhere.you.know��NVH?<..�|BBHz f <� /�aGh(POfHzu`�B.�Hx� Hx� HzHnaGiPPOPOE�&�KG!/Hx/ aGhHPOXOJg��Hx� / aGi(POJgB .�.�fHz8Hn�aGiRLPO/ aGi&@XOJgzHx�Hz/ arPOXOJftzJ.�fHJgBJfN��o/ Hn�/9�AaGiB.�POXOHz/NHn/N�"POPO`/ a�XOJ�g�4tHn/ NTKA�PO��o/ Hn�/9�AaGhB.�POXO/ Hn�NPO`�/aGg/a�pPO��o/ Hn�/9�AaGh`B.�POXOHz"E�/ GG!NHn/ NHl�/ /9�AaGh*Ba�4� ���fHy�Aa¬` Hy�AaL<N^NuNV��/$.�//a//a B $.N^NuH %s �SUBJECT:�DATE:�ORGANIZATION:�FROM:�REPLY-TO:�NEWSGROUPS:�REFERENCES:�FOLLOWUP-TO:�MESSAGE-ID:�No Subject�mailto:�made�Reply to:�Date:�Organization:�Newsgroups:�poster�Followup to:�snews:�snewsreply://�newsreply://�/�;ref=�newsgroups�newsgroup�References:�B %s�rticle <�news:�snews://�nntp://�snewspost:�snewsreply:�newspost:�newsreply:�ftp://�file:/�finger://�http://�https://�wais://�cso://�gopher://� ,>)"��NVH<<$.�BBBBBBBBBBEBJ�A,f�J9�A df�IPaJzfJ�A f�a�z`� �� g Af�B*J�A gHnHza3B/aGdRPOXO. �� g �� f2J�g N (� f|� RHJ(fJgHnHnap:`HnHnaoPO n ��.f (��b�$<�`�& ��c�HzB/NPOJ�g,Hx�:/.aGdHh�a/HnaoN/.`��Hz/.NPOJ�g"Hx�:/.aGd\Hh�a/Hn`�HHz/.NPOJ�g*Hx�:/.aGd*Hh�a/Hnan/.`rHz/.NPOJ�g*Hx�:/.aGcHh�aF/Hnan/.`8Hz/.NPOJ�g4Hx�:/.aGcHh�a /Hnanl/.a��`��HzK/.NPOJ�g Hx�:/.aGcrHh�a/Hn`^Hz'/.NPOJ�g Hx�:/.aGcBHh�a/Hn`.Hz/.NPOJ�g*Hx�:/.aGcHh�ah/Hnam�`THz/.NPOJ�gDz ڮ/a8$HXO �<f,/ GG!NXO 2�>f/ NB2Hj�/a^POXOEJg� .g/�a�vvBXOE�ABHxBBHx�5/9�A RNHx� /9�A y�AN�BHxBBHx�n/9�A RN� nJgJg/`Hz/9�A y�ANXOBHx�n/9�A y�ANHx� /9�A y�AN�".fJg��B .f /�a�N/HnE� ,pNHzG/ NHx�%/.EG!N�JfHx�?/.NPOJg.Hx�/.a($H/ / alPOPOJg/ a�uFXO`/./ alPOHzG/.a�Hx� /9�A y�ANPOPO .g/�a�uBXOBHx�5/9�A y�ANHx� /9�A y�ANBHxBBHx�//9�A y�AN�, nJgJg/`Hz/9�A y�ANPOI�ABHx�//9�A TNG�AHx� /9�A SN� .g/�a�tXBXOE�ABHxBBHx�$/9�A RNHx� /9�A SN� JfJg� BHxBBHx�%/9�A RNBHxBBHx�/9�A RN�0E�AHz/9�A RNBHx�/9�A TNHx� /9�A SN� .g/�`/./9�A RNPO y� fJhgBHx�%/9�A y�ANPOXOG�AHx� /9�A SNPOJf/.Hnaj"POE�ABHxBBHx�%/9�A RNBHxBBHx�/9�A RN�0E�AHz/9�A RNBHx�/9�A y�ANHx� /9�A SN/.a�. n� �<g/a�h`/a�H//9�A RNPOXOE�ABB/9�A RNBHxBBHx�/9�A y�AN y� f�$JhgBHx�%/9�A RNPOXOHx� /9�A y�ANPO .g/�a�r&BXO .g/�a�rBXOJg��E�ABHxBBHx�%/9�A RNBHxBBHx�/9�A RN�0E�AHz/9�A RNI�ABHx�/9�A TNG�AHx� /9�A SN/./9�A RN y� f�$JhgBHx�%/9�A TNPOXOHx� /9�A SNPO .g/�a�q<BXOJg��E�ABHxBBHx�%/9�A RNBHxBBHx�/9�A RN�0E�AHz/9�A RNI�ABHx�/9�A TNG�AHx� /9�A SN/./9�A RN y� f�$JhgBHx�%/9�A TNPOXOHx� /9�A SNPO .g/�a�pfBXO .gDHx�//�GG!N$HPOJfHx�(/.N$HPOJgB nJgJf/a�pBXO .gDHx�//�GG!N$HPOJfHx�(/.N$HPOJgB nJgJf/a�oBXOJg��J�A \g��G�ABHxBBHx�%/9�A SNBHxBBHx�/9�A SN�,.� /9�A y�ANE�ABHx�/9�A RNI�AHx� /9�A TN y� f�JhgBHx�%/9�A RNPOXOBHxBBHx�/9�A SN/.a�Z y� f�J4gBHx�/9�A RNPOXOHx� /9�A TNPO .g�Hz/�ad^POJf�E�ABHxBBHx�%/9�A RNBHxBBHx�/9�A RN�0E�AHz/9�A RNG�ABHx�/9�A SNHx� /9�A y�AN� .g(/�a�Hzj/9�A RNBB/9�A SN�`HzH/9�A RNPO y� fJhgBHx�%/9�A y�ANPOXOHx� /9�A y�ANPO .g/�a�mBXOJg�PJ�A \g�2Hx�Hz/9�A XacPOXOJfHz`HzHnadHXO.�A TI/ K� ,NHz/ NPOPO .f ./�/ N nPO �nf��/aU&$HXOJg��Jg��Hz/ NHx�</ GG!NPOPOJfTHx�&/ NPOJfFHx� / NPOJf8Hx�:/ NPOJf*Hx�// NPOJfHx�%/ NPOJfHx�;/ NPOJg.Hx�/ aX$H/ HnacPOPOJg/ a�ltXO`/ / NPOE�ABHxBBHx�%/9�A RNBHxBBHx�/9�A RN�0E�AHzq/9�A RNBHx�/9�A y�ANHx� /9�A y�AN/.a�R�.���, .f ./�aGWPOJgHzJ`HzO/9�A RNPOE�ABB/9�A RN y� fPOXOJhgBHx�%/9�A RNPOXOHx� /9�A y�ANPO .g/�a�kZBXO .g/�a�kFBXOJg�G�ABHxBBHx�%/9�A SNBHxBBHx�/9�A SN�,.� +/9�A y�ANE�ABHx�/9�A RN y� f�JhgBHx�%/9�A RNPOXOI�AHx� /9�A TNBHxBBHx�/9�A SN�.a� y� fXOJ4gBHx�/9�A RNPOXOHx� /9�A TNPO .g/�a�j8BXOBHx�$/9�A y�ANHx� /9�A y�AN� .g/�a�iBXOJ9�A dfJJ�A,gBHxBBHx�u`BHxBBHx�V/9�A y�ANHx� /9�A y�AN� EJf�IG!anzfXJ�A gHB�A J�A g/9�AHz݄a#|/aGTPOXO/9�AaGT4z#�A <`�a�X`� �� g Af�2BJ�A gHnHza#"/aGT2POXO .�.f* .�c�J9�A dgHn/9�A ` y�A `@Hn`.J9�A dgHn/9�A ` y�A ` J�A,fJ9�@ =fHn/9�A y�ANPO`�GHz&/ a�*HPOJg�vHx�>/ EG!N$Hx�@/ N POPOJg�RJg�Lc�F"B)�B)�^MBJg�Hx�Hz/ NPOXOJg�ZHx�Hz/ NPOXOJg�DHx�Hz/ NPOXOJg�.Hx� Hz/ NPOXOJg�Hx� Hz/ NPOXOJg�Hx� Hz/ NPOXOJg��Hx� Hz/ NPOXOJg��Hx�Hzz/ NPOXOJg��Hx�Hzk/ NPOXOJg��Hx� Hz\/ NPOXOJg��Hx�HzP/ NPOXOJg~Hx�HzD/ NPOXOJgjHx�Hz9/ NPOXOJgVHx�Hz/ NPOXOJgBHx�Hz/ NPOXOJg.Hx� Hz / NPOXOJgI//9�A y�ANPO`�/ Hna]Hz/.a�ަ/a��Jg0I/HzaGRPOJfI//9�A y�ANPOJfBB/9�A y�ANPOXO .g�/�a�f:BXO`� M�<"BB/a�"B�>/ /9�A y�ANBB/9�A y�AN"BC�&BRK�`�hHx�Hz/ NPOXOJg�ZHx�Hz/ NPOXOJg�DHx�Hzt/ NPOXOJg�.Hx� Hzf/ NPOXOJg�Hx� Hz[/ NPOXOJg�Hx� HzQ/ NPOXOJg��Hx� HzE/ NPOXOJg��Hx�Hz:/ NPOXOJg��Hx�Hz+/ NPOXOJg��Hx� Hz/ NPOXOJg��Hx�Hz/ NPOXOJg~Hx�Hz/ NPOXOJgjHx�Hz/ NPOXOJgVHx�Hz/ NPOXOJgBHx�Hz/ NPOXOJg.Hx� Hz/ NPOXOJgI//9�A y�ANPO`��/ Hna[LHz/.a�f/a��Jg0I/Hz~aGPTPOJfI//9�A y�ANPOJfBB/9�A y�ANPOXO .g/�a�cBXOJf� EJg�VJ9�A df:J�A,gBHx�u`BHx�V/9�A y�ANPO.��� /9�A y�ANp7F�L<<N^NuNewsgroups�b %.*s%c[...] �HTNews..... group name too long, discarding. �No matches for: %s��NVH?<B.BBBBBBJ�g��/.�EG!NXOrdp"n� �*f<�Hi�HnaYPO`8/.�NXO"n� 1�*f$|�/ HnaY/.N nB0POXOJfJ.g/.aGN&�XOK�ABHxBBHx�5/9�A UNG�AHx� /9�A SN�BHxBBHx�n/9�A UNI�AHz/9�A TN� E�ABHx�n/9�A RNHx� /9�A SNBHx�5/9�A RN�.��� /9�A SNBHxBBHx�//9�A UN�.� /9�A TNBHx�//9�A RNHx� /9�A SNEBHxBBHx�$/9�A UN�0.��� /9�A SNPOBf�x(Ja}>�rfXJ�A gHB�A J�A g/9�AHzTaL/aGL\POXO/9�AaGLr#�A <`�a�(`�Jg � f�BB`�Jg � f�`��Af��J�A g"I// Hx�Hz-a/aGK�B � gf � b <� <�`NHx� / GG!NPOJf2Hx� / NPOJf$J�A gHzav/aGKPO<�`�T<�` � f�DBBJ�A gHnHza:/aGKJPOXO. ��.fT .�c�BHxBBHx�%/9�A y�ANHl�/9�A y�AN y� f� Jhg�BHx�%`� ��#g�BJ�g� N (� c RHRJ(fA(�J(g��B(J.g//.HnaUPOXOJf�hJg n�^/. Ht�aTPOJf�DBHxBBHx�%/9�A UN/ / a�ގR y� f� JhgBHx�%/9�A y�ANPOXOHx� /9�A y�ANBHxBBHx�/9�A UN� Ht(/9�A y�AN y� fPOJ4g��BHx�/9�A y�ANPOXO`��J.g//.HnaTPOXOJfnJgnf/. Ht�aSPOJfNBHxBBHx�%/9�A y�AN/ / a�ݖ y� f� JhgBHx�%/9�A y�ANPOXOREBg�Jf��BBHxBBHx�%/9�A y�AN/.�HztHna_� ./9�A y�AN y� fPOJhgBHx�%/9�A y�ANPOXO .g/�a�]lBXOBHx�$/9�A y�ANHx� /9�A y�AN� .g /�a�].Bp7F�L<N^NuNewsgroup � %d %d %d %d�Newsgroup status=%d, count=%d, (%d-%d) required:(%d-%d) � No articles in this group. � No articles in this range. � Chunk will be (%d-%d) �%s, Articles %d-%d�%s%s/%d-%d� Block before is %s �Earlier articles�...) �All available articles in �Articles in �HEAD %d%c%c�G %s �"%s"� - � [%.*s]�Status:�Status (ARTICLE %d):�%s%s� Block after is %s �Later articles�snewspost://�newspost://�Post to ��NVH?<,.�(n� *.�BBBB.E�ABHxBBHx�5/9�A RNG�AHx� /9�A SN�BHxBBHx�n/9�A RN$<�AHz/9�A*B UN�./9�A UNE�ABHx�n/9�A RNHx� /9�A SNBHx�5/9�A RN�$.��� /9�A SNHnHnHnHnHzoHy�Aa�L� J�A g*// /./././.HzLaf/aGEv� ".fHzi/9�A*B U`�  .찌o(@Jgl*oHz\/9�A y�A`� R�A Lo �A H(@RLJ�A g// Hz?a/aGDPOPO// /Hz>Hna[ BHxBBHx�//9�A y�AN�(./9�A y�ANPO .g/�a�YfBXOBHx�//9�A y�ANHx� /9�A y�AN".�l�� �A Lm ` �A HHl/�//9�A XHzHy�A raZZ�J�A g/9�A rHza/aGDPOXOG�AHx�(/9�A SN/9�A ra�E�AHzi/9�A RNBB/9�A y�AN�.� f/9�A RNBHxBBHx�S/9�A y�AN�.��� /9�A SNPOBHxBBHx�/9�A y�AN�f fHz`Hz/9�A y�ANXO./9�A y�ANBHx�/9�A y�ANHx� /9�A y�AN�J9�@ lg / a�־XO` BHxBBHx�r/9�A y�AN�( m�V&IK-MHx� Hx� /Hzj/aGCb/a�$@-J����f�GBas~fJ�A f�a�L`�0 �� g Af�B+GJ�A g/ Hza/aGB"POXO.�I~Ee�0; N��p��p�� .�S�D`�Hz/ a� POJ�g�Hx�Hl� E/ a?/ a�|POPO`��Hz/ a�POJ�g��Hl� aVE�/ aGAB2/ HnaLPOPO`��Hz}/ a�˖POJ�g��Hx�Hx�:/ aGAPOHh�a�F./.a>/.a�/.aGA*nA� � fBB`>J9�@ mg6Hz/ a�.POJ�g&Hx�:/ aGANHh�a/HnaL�Jg�Hx� /9�A y�ANBHxBBHx�D/9�A y�AN� HnHzHnaV:POXO .g"/�/.a�6PO .g$/�a�TBXO`/./9�A y�ANPO .g/�a�TBXOJ.grE�AHz/9�A RNPOJ9�@ mg BHxBBHx�9/9�A y�AN�Hn/9�A RNPOJ9�@ mgBHx�9/9�A y�ANPOXOB."nJgdJ�A,f Jg 0� �f��RH"nJ0�f/.HxHz/aG?//9�A y�AN� .g/�a�SBXO y� fJ g�TBHx�D/9�A y�A`�8fHB�A J�A g/9�AHzza r/aG>POXO/9�AaG>*~#�A <`�>Hx� /9�A y�ANE�ABHxBBHx�D/9�A RN�BHxBBHx�9/9�A RN�J9�@ lgHx�Hz/a;`/Hz/aG>POXOE�AHn/9�A RNG�ABHx�9/9�A SNHx� /9�A y�ANHy�A/9�A RN y� f�$J gBHx�D/9�A SNPOXORl�Hx� /9�A y�ANPOJ9�@ lgBHx�P`BHx�r/9�A y�ANPO.��� /9�A y�AN".POo�� й�A Hf//9�A XHzHy�A raSPOPO`$/�*EHm�//9�A XHz>Hy�A raR�J�A g/9�A rHza /aG<POXOHx�(/9�A y�AN/9�A ra�ϴE�AHz/9�A RNBB/9�A y�AN�.� f/9�A RNPOJ�A \g��BBHxBBHx�6/9�A y�ANHx� /9�A y�AN�.���Hz"/9�A XaFPOXOJfHz`Hz$HnaGXO.�A TG/ E� ,NHz/ N// N/.a�E�AHz/9�A RN� ./9�A RNBB/9�A y�AN� .g0/�a�P,BXO` BHxBBHx�6/9�A y�AN�Hx� /9�A y�ANp7F�L<N^Nuwww/source�www/download�www/dump�HTNews: Looking for %s �nntp:�This client does not contain support for posting to news with SSL.�Illegal URL: %s�snewspost�snewsreply�newreply�newspost�%s://%.*s/�//�///�*�nntp://%.*s/�This client does not contain support for SNEWS URLs.�news:/�news://%.*s/�snews://%.*s�GET %.*s%c%c%c%c�HTNews: Proxy command is '%.*s' �POST�URL too long�XGTITLE %.*s�%d-%d�GROUP %.*s�>�<�ARTICLE %s%.*s%s�ARTICLE �HEAD �text/plain�No target for raw text!�lose://%.*s/�%.*s�News: doing HTDoConnect on '%s' �Connecting to NewsHost ...�NNTP�HTNews: Interrupted on connect; recovering cleanly. �HTNews: Unable to connect to news host. �Could not access %s.�HTNews: Connected to news host %s. �HTNews: Proxy command returned status '%d'. �Can't read news info. News host %.20s responded: %.200s�Can't read news info, empty response from host %s�Cannot POST to this host.�Cancelled!!!�mode reader%c%c�GROUP � No such group �ARTICLE <� No such article�XGTITLE�LIST NEWSGROUPS%c%c�uthenticat�uthor�Reading list of available newsgroups.�HEAD�ARTICLE�%s %d%c%c�Reading list of articles in newsgroup.�Reading news article.��NVH?<*n�B.ÕBBBBBHzpG� NXO�gHzgNXO�gHzfNXO�ft#�A,B9�A dJ�A g/ HzIa"/aG62POXOJ9�A vfa��A vfp`�@ 9�A Xg/�a�JB�A XXOB.B.B.B.BHx�Hz_/ GG!NPOXOJgHx�Hz/ NPOXOJf<�BJfHzB/ a�POJg<�BJfJfHz-/ a�POJg<�B.Jf JfJfHz/ a�POJg|�BJf$Jf JfJ.fHz/ a�POJg<�B.Jf6Jf2J.f,Jf(Hx�@/ GG!NPOJfHx�*/ NPOJf|�B.Jf<Jf8J.f2Jf.J.f(Hx�@/ GG!NPOJfHx�*/ NPOJg|�Hx� Hz4/ G� +NPOXOJgHx� Hz%/ NPOXOJfHza(`�J.fJf JfJg�Hx�// EG!N&HPOJfHx�:/ N&HPOJg RKJgJfHzapF�`�BHx�Hz/ a$HPOXOJgJfBJ�Am2 9�A Tg*/9�A P/�a>LPOJg/9�AaG3r#�AXO/9�A P`8J�Am. 9�A Tg&/ /�a>POJg/9�AaG3Br#�AXO/ Hy�A Ta?POJg / a�H.XO/9�A THx�J.fJf <� LJg <� B` <� W` <� `/�HzHy�A XaIJ�Jg(Hx� Hz͠/ a=POXOJgHz͌/ a�B&HPOJg�Hx� Hz}/ a=POXOJg�Hzg/ a�&HPO`�pHx�Hz/ NPOXOJf�fJ-�ghHzG�/ IG!NPOJgPHz,/ NPOJgBHz!/ NPOJg4Hx�Hz / aG3TPOXOJf,Hx�/Hm�aG3 $HPOJgJ*�fGB.|�` -�/�gG�` -�/�gG�`G�Hx�Hz/ a$HPOXOJgJfBJ�Am2 9�A Tg*/9�A P/�a<:POJg/9�AaG1nr#�AXO/9�A P`8J�Am. 9�A Tg&/ /�a;POJg/9�AaG10r#�AXO/ Hy�A Ta= POJg / a�FXO/9�A THx�Hz`�bHx�HzZ/ NPOXOJfHza`�BHx�Hz / NPOXOJf�JJ-�gHHzBE�/ GG!NPOJg0Hz/ NPOJg" �/f,Hx�/Hm�aG1$HPOJgJ*�fGgB.|�`&J`G�Hx�Hzj/ aH$HPOXOJgJfBJ�Am2 9�A Tg*/9�A P/�a:POJg/9�AaG0 r#�AXO/9�A P`8J�Am. 9�A Tg&/ /�a:POJg/9�AaG/r#�AXO/ Hy�A Ta;POJg / a�DXO/9�A THx�HzE/ aG0/ Hy�A Xa;n�`tG�JfGeB.|�J�Am2 9�A Tg*/9�A P/�a9POJg/9�AaG/0r#�AXO/9�A PHy�A TE� ,pNHzHy�A XNPOPOHx�Hzf/ E� +NPOXOJg*Hx� Hzɼ/ NPOXOJgHx� Hzɳ/ NPOXOJf�n/9�A THnI� ,pNHx�Hzž/ a$H�Jg(Jg$/ Hx�HzHnaG// Hy�A TN�`/9�A THx�HzHnaG/fPOPOB.Jg / a�CPXOHx� Hx� Hx� Hx� I/ Hx�Hz~E/ aG/&� J�A g&/ / aG/4XOY/�Hzca/aG.,POPOHzj/ aG./9�A XHnE� ,pN/ Hy�A XN�JfJg*Hx�// EG!N&HPOJgRK`@Hx�:/ NG�PO`0Hx�/Hk�aG.$HPOJgJ*�fG]B.|�`G�J.f JfJfJgA`�J.g"/ aG.NXO ���b�8/ Hx�Hz`��J.g��Hx�// IG!N$HBBPOJgzB/ aG.XO ���b��Hx�/ Hna*�/HnHnHzQ/ a��JoXIA�AU0��gFHx�-/ NPOJg "nf.r-A`&/ aG-XO ���bvHx�/ Hna*VPOXOHnHx�HzHnaG-4POPO`��Hx�</ EG!NPOJW�IDHx�>/ NPOJW�ID/ aG-ЃЂXO ���c< .g/�a�@BXO .g/�a�@BXOHz?a <p`� <� Jg <� B/�/ "BC8 "<��/ <� Jg <� D/�Hz"HnaG,f�E/ aG,zA�� � B/ Hna7POXOJfX 9�A Xg/�a�@"B�A XXO .g/�a�@ BXO .g/�a�?BXO .g /�a�?BB`� <J.f��Jf��Jf��Jf~J.grfpJ.fj"n� i�XgDHx�Hz_/ aG+POXOJf, JROLIFCZJ.`RJ*�fB�J.fJ9�@ g<��A dJ9�A dg�#� �A(/.� /.�/.�HzaL.a_#�A `POPOfz 9�A Tg/�a�>B�A TXO 9�A Xg/�a�>B�A XXO .g/�a�>BXO .g/�a�>BXO .g/�a�>BXOHzwa`� P#�A#�A#�A#�A#�A #�A$`����@dHzaZXO`� Hy�Aa.XO`� J.fhJfdJf`Jf\#� �A(/.�/.�/.� a#�A P#�A#�A#�A#�A#�A#�A�#�A#�A#�A POXOBGJ�Al�Hzk/9�A XaG)POJf/9�A THx�Hz` .g/�`/9�A XHxHzHnaG)vPOPOJ�A gHnHziax/aG(POXO��@dHzlE��|NHy�AHx�wHzqHnap$�� f��J�A gHzPa/aG(.PO��@dHz`NXOJ.f6Jf2Jf.Jf*J9�A dgB/9�A ` y�A`B/9�A y�ANPO 9�A Tg/�a�<B�A TXO 9�A Xg� /�a�<B�A XXO`� Jl�/9�AaG'Pr#�AXOJ�A gHzad/aG'tPOJo�J.f6Jf2Jf.Jf*J9�A dgB/9�A ` y�A`B/9�A y�ANPO/9�A THzHy�A ra=HPOXO 9�A Tg/�a�;B�A TXO 9�A Xg/�a�;B�A XXO .g/�a�;BXO .g/�a�;BXO .g/�a�;zBXOJg�2/a�.a�;^XO`�J�A g/9�A THza^/aG&nPOXO/9�AaVXOJ.gBE/ aG':/�/ /9�AaG'l$�POPOJ�A g/Hza/aG&POXOBa�P$�L< Q-A r"nXOrg�/9�AaG%r#�AXO f����@dHzaXOJ.f6Jf2Jf.Jf*J9�A dgB/9�A ` y�A`B/9�A y�ANPO 9�A Tg/�a�:2B�A TXO 9�A Xg�,/�a�:B�A XXO`�Jo� .g/�a�9BXO .g/�a�9BXO .g/�a�9BXOJg /a�9XOJ.f6Jf2Jf.Jf*J9�A dgB/9�A ` y�A`B/9�A y�ANPOA�AJg//9�A THzxHy�A ra:POPO`/9�A THzHy�A ra:POXO/9�A rHx/.�aB`� ���f r#�A \`(B�A \J.f JfJfJgHzqa|XO`�J.fJf JfJg��J�A \gJf�2BJfJgp/�/.a(POf�Hz9aXO 9�A Xg/�a�8B�A XXOJg:/.Hy�A Ta/PPO .g/�a�8`BXO .g/�a�8LBXO .g�/�a�86B`�Hx� Hx� HzE/ aG$/ a�$�� g� ��f^/9�A Ta�$�XO ��f* 9�ArgJfJf/�aG"r#�AXO ��f�NHna�XO g�8/ a� $�XO g�$Jl Jo�`� ��fRJ.gLHx�Hz/ aG#POXOJf4Hx�HzHy�Aa-bPOXOJfHnHy�AaG#@POJg� ��f>J.f8J.f2Hx� HzHnaG#*POXOJfHzHy�Aa,POJg� L< Q-A r"nrgp ��Tgh ��gjJg.J.gHx�Hzv/ aG"POXOJg��Hy�Aazd`��@dHy�Aa}h.�AaG!Br#�AXO`� ��f��J.g^Hx�Hz/ aG"XPOXOJfFHzHy�AE� NPOJf.Hz Hy�ANPOJfHx� Hx� Hz/ aG!POPO`�@/9�A Ta�XO ��g�* ��f~ 9�ArgJfJf/�aG r#�AXOJo� `LJ.f JfJfJgD ��TgHzayRXOJg"/a�`/a�XOJg /a�5@BXO$<`��J.g��@dHz/a|"/.a�`��J.glJl<Hx� Hx� /. <� J.g <� /�Hz HnaG B.v�`�.��@dHza{/./.Hna�4$�POPO`��@dHza{/.� a�$�PO f��@dHza{lt7FXOJ.ffJfbJf^JfZ f,J9�A dgB/9�A ` y�A`B/9�A y�ANPO`&J9�A dg/9�A ` y�A` /9�A y�ANXO 9�A Xg/�a�3B�A XXOJg:/.Hy�A Ta*PO .g/�a�3BXO .g/�a�3BXO .g/�a�3BXOJg/a�.a�3r `��Rrl�J.f6Jf2Jf.Jf*J9�A dgB/9�A ` y�A`B/9�A y�ANPO 9�A Xg/�a�3B�A XXOJg:/.Hy�A Ta)PO .g/�a�2BXO .g/�a�2BXO .g/�a�2BXOJg/a� .a�2 <L<N^NuNV��a�$N^Nunntp�newsreply�snews��abcdefghijklmnopqrstuvwxyzABCDEFGHIJKLMNOPQRSTUVWXYZ0123456789./-_$�NV��ABC�A\B1�R ���cJgC�A\I��Jf��A N^Nu0123456789abcdef��NV��.� � �� bI`.� ��b �I`� ��b �I`BN^NuHTGopher: adding URL: %s �NV/$.�".� pB6QB@Sd|�-A|�-BJ�A g/HzaP/aG`POXO��A BHxHnHnB/9�A4 y�APN//9�A4 y�AHN�BB/9�A4 y�ATN$.|N^NuGopher Menu�HTGopher: Interrupted in HTGetCharacter, apparently. �HTGopher: Menu item: %s �Transferred %d bytes�(HTML) � � (TEL) �telnet://%s@%s/�telnet://%s/�(3270) �tn3270://%s@%s/�tn3270://%s/�(FILE) � (DIR) � (CSO) � (BIN) � (UUE) � (?) � (IMG) � (SND) � (HQX) �(MIME) � (MOV) � (PDF) �(UNKN) �//%s/%c�%c�%c%c%c�gopher://error.host:1/0�HTGopher: Bad menu item. �NVxH?<$.� BBI�BBxE�APBHxBBHx�7/9�A4 RNG�ADHx� /9�A4 SN�BHxBBHx�5/9�A4 RNHx� /9�A4 SN�BHxBBHx�n/9�A4 RN/a �g/�`Hz/9�A4 y�AHNPOG�ATBHx�n/9�A4 SNE�ADHx� /9�A4 RNBHx�5/9�A4 SN�.��� /9�A4 RNG�APBHxBBHx�/9�A4 SN�.��� /9�A4 RNBHxBBHx�//9�A4 SN�.a XOg/�`Hz/9�A4 y�AHNXOBHx�//9�A4 y�ATNHx� /9�A4 y�ADNBHxBBHx�V/9�A4 y�APN�,.<G!aIn|g�pJ�A g"J�A g�^Hza/aGPO`�F �� gAcRL`BA� ڀ(HJ�A g/ Hza@/aGPPOXO nx�l"/HzE/ aG/ as-ExPOPO �.f �� g�J�g�Jg��Jg|( Hx� /aG*HPOJgfB �0f ��9g ��5f�Hx� / "GN&POg>"CRBHx� /"GN&HPOJg&�:Hx� / "GNPOJgB +�0�fJ+�fB �0f0/aGbSXO"D 1� �f @JmBS � gJl<�i �wf"Hz/9�A4 y�AHN/ /a�~POPO`� �if(E�AHHz/9�A4 RN//9�A4 RNPOPO`�Jg�XB| �8f*HzZ/9�A4 y�AHNPOJg // HzF`./HzN`> �TfJHzO/9�A4 y�AHNPOJg// Hz;Hn|a,POPO`�/Hz3Hn|a,POXO`��I|Ce��0; N���������������������������������������������������������������������Hz`RHz`LHz`FHz`@Hz`:Hz`4Hz~`.Hz`(Hz`"Hz`Hz`Hz`Hz` Hz`Hz/9�A4 y�AHNPOI//HzHn|a+|$MPOPOJgdBA�A\J0(�gI/Hz^Hn|a+POXO`4pC1�I/��I1�I/�Hx�%Hz+Hn|a*�RJJfHz/.|aGPOJg /.|/a�`//9�A4 y�AHNPO .|g@/�a�)jB|XO`0J�A gHzan/aG~POHn�/9�A4 y�AHNPOHx� /9�A4 y�ADNI�PO`�G�ATBHx�V/9�A4 SNE�ADHx� /9�A4 RNBHx�/9�A4 SN�.��� /9�A4 RNBHx�7/9�A4 SNHx� /9�A4 RN/9�A4 y�A<NL<PN^NuCSO Search Results� Search Results��NV�H08&.� I�BE�APBHxBBHx�5/9�A4 RNHx� /9�A4 y�ADN�BHxBBHx�n/9�A4 RN/a �g/�`Hzh/9�A4 y�AHNPOG�ATBHx�n/9�A4 SNE�ADHx� /9�A4 RNBHx�5/9�A4 SN�.��� /9�A4 RNBHxBBHx�//9�A4 y�APN�.a 2 XOgb/�/9�A4 y�AHNPO`tBHxBBHx�0/9�A4 y�APNHl�/9�A4 y�AHN�BHx�0/9�A4 y�ATNPOXO`�tE�AH/.�/9�A4 RNHzu/9�A4 RNPOPOBHx�//9�A4 y�ATNHx� /9�A4 y�ADNBHxBBHx�V/9�A4 y�APN�,GG!aBtrg�� �� gAcRL`BI� ��2g�� ��5g� ��-fHx�:Hx�:/ NPOHh�N$HPOJg*g4BHx�V/9�A4 y�ATNBHxBBHx�0/9�A4 y�APN�$Hj�/9�A4 y�AHNHx� /9�A4 y�ADNPOPO*g4BHx�0/9�A4 y�ATNBHxBBHx�V/9�A4 y�APN�$*`�E�ADHx� /9�A4 RNBHx�V/9�A4 y�ATNHx� /9�A4 RN/9�A4 y�A<NL N^NuCSO index� index� This is a searchable index of a CSO database. � Press the 's' key and enter search keywords. � The keywords that you enter will allow you to search on a� person's name in the database. �NV��H08&.�$.� E�APBHxBBHx�5/9�A4 RNHx� /9�A4 y�ADN�BHxBBHx�n/9�A4 RN/a �g/�`Hz/9�A4 y�AHNPOG�ATBHx�n/9�A4 SNE�ADHx� /9�A4 RNI�APBHxBBHx�>/9�A4 TN�(.��� /9�A4 RNBHx�5/9�A4 SNHx� /9�A4 RNBHxBBHx�//9�A4 TN�0.a XOg/�/9�A4 y�AHNPO`$E�AH//9�A4 RNHz/9�A4 RNPOPOBHx�//9�A4 y�ATNE�AHHz/9�A4 RNG�APBHxBBHx�S/9�A4 SN�(.� /9�A4 RNBHxBBHx�S/9�A4 SN�.� /9�A4 RNHz/9�A4 RN/aB�Jf //aPO/9�A4 y�A<NL N^NuGopher index� This is a searchable Gopher index. � Please enter search keywords. �NV��H08&.�$.� G�APBHxBBHx�5/9�A4 SNE�ADHx� /9�A4 RN�.��� /9�A4 RNBHxBBHx�n/9�A4 SN�.aJ XOg/�`Hz(/9�A4 y�AHNPOG�ATBHx�n/9�A4 SNE�ADHx� /9�A4 RNI�APBHxBBHx�>/9�A4 TN�(.��� /9�A4 RNBHx�5/9�A4 SNHx� /9�A4 RNBHxBBHx�//9�A4 TN�0.a XOg/�/9�A4 y�AHNPO`$E�AH//9�A4 RNHz`/9�A4 RNPOPOBHx�//9�A4 y�ATNE�AHHz+/9�A4 RNBHxBBHx�S/9�A4 y�APN�(.� p/9�A4 RN/aPOXOJf //aHPO/9�A4 y�A<NL N^NuHTLoadGopher�../../../WWW/Library/Implementation/HTGopher.c�NV��H08$n� &n�JfHzHzacPOJg:I ��%f&RJI/N�IXOgI/�N�XO`RJJfBL N^NuNV��/ $y�A JglA�4 *�gJg/�a�2B�XOA�d *�gJg/�a�B�XOA�D *� gJg/�a�B� XO $Rg/�a�XO`$nN^Nu$(FID)�%d�$(FDESC)�%.2046s�$(FDEF)� checked��$(FNDX)�*�$(FSIZE)� size=%d maxlength=%d�$(FSIZE2)� maxlength=%d�$(NEXTFLD)�$(QFIELDS)�$(RFIELDS)�$(NAMEFLD)�name�Name�$(HOST)�$(PORT)�NV��H><&n�$.� *.�*n�(.�$m�Jg�BHx�Hz/ IG!NPOXOJf /*�Hz `��Hx�Hz/ NPOXOJf /*� Hz`��Hx�Hz/ NPOXOJf <� J�$g. <� `&Hx�Hz/ NPOXOJf <� J�g <� /�/aG |PO`dHx�Hz/ NPOXOJf$/*� "*� p7m /�Hz/aG (POPO`,Hx� Hz/ NPOXOJf/*� Hz/aGPOXO`vJg�"BBHx� Hz|/ EG!NPOXOJf�� m�Jf$y�A `$P -�$|g,mJg `L|g4`DJg�J�0g|�g0$RJf`(Jg��|�g$RJf`Jg��J�0f$RJfJg��+m��+m��`��Hx� Hz/ NPOXOJgHx� Hz/ NPOXOJf<+m��+m��B�+|� ,� +�Q�g0|�+H�$J� g�RH+H�$`��Hx� Hz/ NPOXOJfL$y�A Jg:GG!Hz/*�NPOJgHzw/*�NPOJfJ�g|%F�`$RJf+J�`��Hx�HzL/ NPOXOJf//aGPO`zHx�Hz2/ NPOXOJf/-� Hzy/aG@POXO`PBJg< ��)g4"B�RKR|dB1�"D$Q/aG0/�// j�NBPOPO`"B�)�"AB1(/aG"E"L<|N^Nuindexed �default �public �lookup �url �max �NV��H 0$n�B�B� B�,B�B�B�0B�(B�$$*�/a Hz/G� NPOXOJgr%A�Hz/NPOJgr%A�$Hz|/NPOJgr%A�0Hzp/NPOJgr%A�Hzd/NPOJg r%A�%A�$HzQ/NPOJgHj� HzHh�a�`r %A� BL N^NuHTLoadCSO: Interrupted in HTGetCharacter, apparently. �HTLoadCSO� ��NV��H?<*.�*EBB�A B,<Ba5Brg�8J�A g.J�A gHz|a\/aGlPOa�"EB <`� �� g"n� CX cRM`R`bB*E ��2g� ��5g� ��-f -�2�f�zBB$E6|� �:f BJf( ؋/aGx.�XO`JfI�RJRKRJfJg�|fpHu(�aG&@RKXOr dD"CA�D )� gJg/�a�h"CB� XO/ a�"C#H� XOfHzHzQa\^POHu(�"C/)� aGNPO`�Hx�Hx�a�<$HPOJfHz}Hza\"POJg"C"`#�A & BC�4%I�/ aG&@RKXOrd / a�F%H�XOfHz-Hza[PO/ /*�aGC�d%I�Hu(�aG&@TKPOXOrPd / a�%H�XOfHzHzya[POHu(�/*�aGx j�ɸĸA�D%H� B/aG%@�/ a�POPO,`�"EJgBB`//aG,p`pL<N^Nu </DL></FORM><HR> </BODY> </HTML>�$(NEXTFLD) �$(RFIELDS) <input type="checkbox" name="r_$(FID)"$(FDEF)> $(FDESC)<BR>� <option>default<option selected>all<option>selected</select><BR>� <DD>Returned data option: <select name="return">� <DT>Output format:� </DL> <P><DL>� </DL>� <DD><input name="q_$(FID)" type="text" $(FSIZE)> $(NEXTFLD)�$(QFIELDS) <DT><I>$(FDESC)</I>$(FNDX)� <DD>First: <input name="q_$(FID)" type="text" size=48$(FSIZE2)>� <DD>Last: <input name="q_$(FID)" type="text" size=49$(FSIZE2)>�$(NAMEFLD) <DL COMPACT> <DT><I>$(FDESC)</I>$(FNDX)� <DD>� <DT>Search parameters (* indicates indexed field):�<P><DL>�<input type="reset" value="Clear fields"> ]�[ <input type="submit" value="Submit query"> | �<HR><FORM method="POST" action="cso://$(HOST)/">�one of the entered fields must be flagged as indexed.�in the form below and activate the 'Submit query' button. At least�To search the database for a name, fill in one or more of the fields�<H2><I>CSO/PH Query Form</I> for <EM>$(HOST)</EM></H2>�<HEAD> <TITLE>CSO/PH Query Form for $(HOST) Seek fail on %s NVH?<*n,.B-nB-n Br-ABBAA Jg.(p<BJg 4$(fT 4((fJB5HJg"F$Q/ aGB// / jNPOPOA(J4(g 4)(gRJ4(f-C-B/HnHn/ /a&.$."G(q<(. .g/aG*XO"GJ<gnG<(SJ4(gP"GE< 4$(f:/Ht(/.aGPOXOJf"JfYKS/"aG$SXO`S(RB`RJ4(fJgBXKRJf .gzB/HzHna"F$Q/.aG6//./ jN .g@/aBXO`0(HRrd"B5H"F$Q/ aG// / jNBPOPORJ4(fl HRB5HRAA J<fDJg"F$Q/ aG// / jNBL
    Information/status

    Entry %d:
    %s
    %s
    %s
    %s
    <>news:snews://nntp://snewspost:snewsreply:newspost:newsreply:ftp://file:/finger://http://https://wais://mailto:cso://gopher://
    NVH?<*.B(BB.r-A&$@BXOo D :fBJf"@IH$ RHRnJg/aG&@XOgrg.HzzHna$"E$Q/.aG//./ jNJf0HzTHna"E$Q/.aG//./ jN`0/ HzNHna"E$Q/.aGt//./ jN-K`/ `B b,g&  fRL  g&LJg0 :f$B/ aGSXOkA  fBSHSk`RKJfJg  fRK  gJg$yA Jgd/ /*aGPOJf * g (@`$RJfJg>Jg8/ / / HzHna "E$Q/.aG//./ jN$`/ HzHna "E$Q/.aGZ//./ jN nB$KJg fHzTHnaTRJPO`HxHzA/ "CNPOXOJg|HxHz// "CNPOXOJgdHxHz / "CNPOXOJgLHx Hz/ "CNPOXOJg4Hx Hz/ "CNPOXOJgHx Hz/ "CNPOXOJgHx Hz/ "CNPOXOJgHxHz/ "CNPOXOJgHxHz/ "CNPOXOJgHx Hz/ "CNPOXOJgHxHz/ "CNPOXOJgHxHz/ "CNPOXOJgtHxHz/ "CNPOXOJg^HxHz/ "CNPOXOJgHHxHzs/ "CNPOXOJg2Hx Hzd/ "CNPOXOJgI/HzHna POXO`BHz@/"GN/ Hna$Hz4/.a>//"GN. &/"GNPOJg2I/HzaGPOJfI/HzbHna POXOJfHzHna:PO .g/a BXO`HzHna "E$Q/.aG//./ jN nB$KJgZ fHzHnaRJPO`HxHz/ "CNPOXOJg|HxHz/ "CNPOXOJgdHxHz/ "CNPOXOJgLHx Hz|/ "CNPOXOJg4Hx Hzo/ "CNPOXOJgHx Hzc/ "CNPOXOJgHx HzU/ "CNPOXOJgHxHzH/ "CNPOXOJgHxHz7/ "CNPOXOJgHx Hz&/ "CNPOXOJgHxHz/ "CNPOXOJgHxHz/ "CNPOXOJgtHxHz/ "CNPOXOJg^HxHz/ "CNPOXOJgHHxHz/ "CNPOXOJg2Hx Hz/ "CNPOXOJgI/HzBHnaPOXO`BHz/"GN/ HnaHz/.a//"GN. &/"GNPOJg2I/HznaGPOJfI/HzHna~POXOJfHzNHnaPO .g/a2BXO`Hz)Hna|"E$Q/.aG2//./ jN`6 f /HzHnaF"E$Q/.aG//./ jNJ.grg.Hz^Hna"E$Q/.aG//./ jN .g /avBBL text/htmlHTLoadCSO: Looking for %s csoHTLoadCSO: Interrupted on connect; recovering cleanly. HTLoadCSO: Unable to connect to remote host for `%s'. connectfields%c%cHTLoadCSO: Connected, writing command `%s' to socket %d Sending CSO/PH request.HTLoadCSO: Unable to send command. sendCSO/PH request sent; waiting for response.No response from server!Sorry, no known way of converting %s to %s. CSO/PH Results on %s &%d=query %s="%s"Warning: non-lookup field ignored
    return=allselectedError: At least one indexed field value must be specified! return all return %s%c%c

    CSO/PH command:

    HTLoadCSO: Writing command `%s' to socket %d NVH?<*n(. ..tiBBHzan*XOJ9A faJfp`Jfp`JA g/ Hza$/aG4POXOHyA0HxiHz/ a6t$@POPOf8JA gHza/aGPO@dHzFaI <`nJl.JA g/ Hza/aGPOXOHza(`POPO@dHzI|N/ N// /9A0aGD$@Jg / aXOJl*JA gHza/aGPOHzqa`@dHzNXOIrCe0; Nnn//9A0//Hz;`//9A0//Hzs`//9A0//Hz`///a~#A4 P#A8#A<#A@#AD#AH#AL#AP#AT#AX//a`///a(#A4 P#A8#A<#A@#AD#AH#AL#AP#AT#AX//aʚ`T//9A0//Hzj`4//9A0//Hzd`"//9A0//Hz]`//9A0//Hz[a.aPOPO.A0aGݎp7FL<*.&. $BHzv/EG!NPOJgHzi/NPOBJfx`xHx@/EG!NPOJgHx@/NPO`B`> BJg8CAUICf _g -g :g .g @fRHJfHx@/aG (HPOJgB`(BBHx:/ EG!N*HPOJgBJgJf JA gFHza/aG`0/ a,XOJfBBJA g/Hza/aGپPOXO/HzHnE 6N/HzHnN/./.a2 .g/aFBXO .g/a0B`JgHx:/N&HPOJgBJ9@glHzOEG!bNHzvNHzNHzNHzN/Hz3N/ Hz^N$Jg /HzYNPOJg / HzZNPOJg / HzZNPOHz\N`Jg|g/HzJaGZPOJg|g/ HzZaGBPOHyAjaGtXO|fjHzbHxHzjE/ G 9VN/ HxHzR/ N < EJg < E// av/HxHz&/ NHxHz/ a$`Z|fHz`HzHxHzG/ E 9VN/ HxHz/ N.HxHz/ NHxHz/ aL/.apFL<|N^NuHTTelnet: Can't output a live session -- must be interactive! file:NVH0 &.Jg JA gHza4/aGDpF`vHxHz/Eq~N$HxHz/N$HJgJf vFJA g Hza/aG` / /a&POJg / aXOJg/a L N^NutelnetNVr#A\pN^NuNV/BtWDRtl-nBHxHnHnB/9A` yA|N$.|N^NuHTFinger command to be sent: %sHTFinger: Unable to send command. Disconnecting. HTFinger: Reading finger information Finger server on : HTFinger: Interrupted in HTGetCharacter, apparently. Connection interrupted.news:snews://nntp://snewspost:snewsreply:newspost:newsreply:ftp://file:/finger://http://https://wais://mailto:cso://gopher:// ,>)"NVH<<&.(. /aG$@B$BXOJfp`>/9A\aXOJA g/Hz>az/aGԊPOXO/ //9A\aGը$@POXOJl6JA gHz&aB/aGRPO/9A\aGz#A\ `/././.a#A` P#Ad#Ah#Al#Ap#At#Ax#A|#A#AKAPOXOJA gHza/aGPOIBHxBBHx7/9A` TNEHx /9A` RNBHxBBHx5/9A` TNHx /9A` RNBHxBBHxn/9A` TNGHzb/9A` SN./9A` SNQMBHxn/9A` UNHx /9A` RNBHx5/9A` UN$. /9A` RNBHxBBHx/9A` TN. /9A` RNBHxBBHx//9A` TN. J/9A` SNBHxBBHx&/9A` TN./9A` SNBHx&/9A` UNHz/9A` SNJg/`HzkHnaXO.aGSXOk" n0  g  fB0QB@Sd/./9A` yAtNPO .g/aBXOBHx//9A` yANHx /9A` yApNBHxBBHxV/9A` yA|N,GG!a,zgpJA g2JA gHzaF/aGVPO@dHza-`Jz g"BAcR`"BBE$ JgHxHz/ NPOXOJgZHxHz/ NPOXOJgDHxHzu/ NPOXOJg.Hx Hzg/ NPOXOJgHx Hz\/ NPOXOJgHx HzR/ NPOXOJgHx HzF/ NPOXOJgHxHz;/ NPOXOJgHxHz,/ NPOXOJgHx Hz/ NPOXOJgHxHz/ NPOXOJg~HxHz/ NPOXOJgjHxHz/ NPOXOJgVHxHz/ NPOXOJgBHxHz/ NPOXOJg.Hx Hz/ NPOXOJgI//9A` yApNPO`/ HnaHHz/.a\b/aJg0I/HzaGPPOJfI//9A` yApNPOJfBB/9A` yANPOXO .g/aBXO`Hx /9A` yApNPO`/9A\aGζz#A\XOGABHxV/9A` SNEApHx /9A` RNBHx/9A` SN. /9A` RNBHx7/9A` SNHx /9A` RN/9A` yAhNBL< wg WfHx Hx / Hz8HnN`Hx Hx / Hz*HnN`Hx Hx / HzHnN` /f2Hx/HkaGr$HPOJg Hx Hx / HzHnN` wg Wf* +/f" g| `B+Hx Hx / Hz`f wg WfJ+fHx Hx / Hz}`BHx// aG$HPOJg B wg WfHx Hx / Hz8`Hx Hx / Hz2HnaJA g/.Hz#a/aGɨPOXOHyA\HxOHz(/.a$@POPOJA g/ HzaZ/aGjPOXOfTJA gHza4/aGDPOHza% XO .g/aBXO .g/aB`Jlj/9A\aGȲr#A\XOJA gHza/aGPOHza!XO .g/a݄BXO .g~/anB`nJA g/.Hzan/aG~POXO .g/a6BXO/././. //.ahJg$Hza XO .g/aB` .g /aBp7FL< N^Nuunknownfont-sizefontnum-docs-to-requestconfidencelast-contactedcontact-atupdate-timescriptconfigurationwindow-geometrysourcekeyword-listdescriptionmaintainerfreecost-unitcostdatabase-nametcp-portip-nameip-addressversion0123456789ABCDEFNV.  bI`. b I` b I`BN^NuHTWSRC: Unknown field `%s' in source file NVH 0$n. *dte0; N >,f (ft` )ft` :f|B'~t`n  b J'~B(hR'~B'zAAJg6&HHjh *'z/3 aGPOJg j'zC%I'zJf *'zJ f*JA gHjhHz a/aGŮt%B'zt`t` )ft`  cB'~ "gt (ft%Bd J'~AhR'~`  bB *'~B2hHjh *'zHr at`~ )f *'~B2hHjh *'zHr at`Z *'~ 'nRhR'~`H "f *'~B2hHjh *'zHr aЈt` \ft` *'~ 'nhR'~t%BdL N^Nu: ; NOT GIVEN in source file; NVH 0&n$. "k$QAA/0,/ jNPOJ,g0 k"PHz/ iN k"P/3,/ iN k"PHz` k"PHz|/ iNL N^Nu.src WAIS source file index descriptionAccess links:wais://%s%s%s/%sDirect access (or via proxy server, if defined)MaintainerHostNVH00&n.JgB/+Hna/.aG<$@POXOvl"Hz0 nHha͞POJf nB0 k"PBHxBBHx5/ iN k"PHx / i N k"PBHxBBHxn/ iN k"P/./ iN k"P < \Jg < \// iN k"PBHxn/ iN k"PHx / i N k"PBHx5/ iN( k"PBHxBBHx// iN k"P/./ iN k"P < \Jg < \// iN k"PBHx// iN k"PHx / i N .g/a֜BXO k"PBHxBBHx#/ iNJg k"PBHxBBHx%/ iN k"PHz/ iN y f Jhg k"PBHx%/ iNPOXO k"PBHxBBHx/ iNJgJgBHx/+a$H/ +"f"< \/"< \Jg"< \//+HzHna.B/+a k"PHz/ iN k"PBB/ iN k"PHz/ iNPOJg / aDXO .g(/a4BXO`Hx/ ENHx/ NPOPO y fJ4g k"PBHx/ iNPOXOJ(g k"PBHxBBHx%/ iN k"PHzi/ iN y f Jhg k"PBHx%/ iNPOXO k"PBHxBBHx/ iN k"P/+(/ iN y f J4g k"PBHx/ iNPOXOJg k"PBHxBBHx%/ iN k"PHz/ iN y f Jhg k"PBHx%/ iNPOXO k"PBHxBBHx/ iN k"P/+/ iN y f J4g k"PBHx/ iNPOXO k"PBHx#/ iNPOXOJ,gJ k"PBHxBBHxV/ iN k"P/+,/ iN k"PBHxV/ iNPOXO k"P/ iNL N^NuNV/ /$.$n JgI//aPOJf$.$nN^NuNVH0 &. . $Ԯ$@cI//a^PObL N^NuNVH 0&nHx/ a@BPOAAJg$H 3,g/ajB,XOXJRJfJg/ aPL N^NuNV/.aN^NuWSRCParserHTWSRCConvert../../../WWW/Library/Implementation/HTWSRC.cNV/ / &nHx'aX$HXOJfHzHzaPO$A/./+/. al%HpB QB@SdBd J $n&nN^NuHTAAForwardAuth_set../../../WWW/Library/Implementation/HTAABrow.cAuthorization: NVH0 $n&. Jg/ aG8XOtԀ`tJg /aG"XOԀ 9A"g/aBA"XO/Hxa#A"POfHzDHzTaPOHxHzs/9A"aG`POXOJg./ /9A"EG!NHz[/9A"NPOPOJg //9A"NL N^NuNV 9A"g/aRBA"N^NuHTAAServer_newNVH00&.&n .HxHxa8$HPOJfHzHzaPOB%KnpP%@BG %N%H N%HJg // aƬPOJA fN#A / /9A a J L N^NuNVH 8(nJg , gD/a$SXOk$//, a0 POg/aXOQBBSd/, aB XO&lJg &kJg$SJgD g /aBXO *g/a BXO *g/aBXO/ aXO`/,ahBXO g /aBXO/ /9A a2POJg/ aΪLN^NuNVH80&.$. .Jg@&yA JntPJg &kJg$SJg f//aGrPOJfָ*f J` L N^NuproxyserverHTAASetup_lookup: resolving setup for%s %s (%s:%d:%s) matched templateHTAASetup_lookup:%s `%s' %s `%s' did NOT match template(so probably not protected)(null)HTAASetup_lookup: No template matched%s `%s' %s NVH <*n$n (n.Jn4|PJgJgJgJgI// / apPOXOJg&h JA g2/ / / < g`Jg < gZ/HzHza/aGJg &kJg$SJgl/ /*a-POJg,JA g /*Hz/ HzHza/aG䷮ J`^JA g/*Hz/ Hz|Hzar/aG䷂`JA g&Hz f < h/HzHza>/aGN L<N^NuHTAASetup_newNVH8(n&n JgJgJf`XHxHxa$HPOJfHzHzPaPOB*$B/ Hja€PO%n%n / /, a` J LN^NuNV/ /$nJgf *g/aZBXO *g/aBXOB j 0,g /a"0XORrl * g/aB XOJg/ a$.$nN^NuNV/ /$nJgJA g Hz/HzHzad/aGtBB/ R/(a(HPOPOJf.J9@g& *g HxHz/a*HPOXOJgJg&MJf R&P R (ozPg/Hz~Hna0POXO/EG!NXO f < l>/NXO .f < l9/ f < l>/ < g`Jg < gZ//Hz)HnaJg / a`XO .g/aPBXO-lBI/HnHn/.aPOPO .g/aBXO ,g/aBXO ,g/aBXO)n)n lJgJf`JfHziHyAa` ,f < l9/GG!N$XO ,f < l9/N BKXOzfE! 9Af < l9/NK` 9Ag/aLBAXO/ HxaZ$HPOJfHzHza @PO ,g// aG0PO`BHz/ GG!NPO ,g// NPOzfHz/ NHz<.Ba"*BBJ9AfAJA gHz&au/aGPO/./. /.a POXO,< +8a!,(HJgFJg2JA g/ Hzaut/aG䦄POXOHx:/ aGRPOJg-LG/ E -N$/ N$H&nPOJgHz/aPOJg`Hz/"FNPOJf>JgJg JgJf < l9JgJg / < l9Jg Jg < dc/ < l9JgJg / < l9Jg Jg < dc// HzDHna/.a\ .g/aZBXO`/ a$XOg^//aPOJf:HxHxaF*HPOJfHzHza,POpABYHQB@Sd/ a+,RXO`JA g < xJg < x// Hzas/aGPOPO``Hz/"FNPOJfPJA g/ Hzas/aG䤸POXO/ HnaRPO` JA g/ Hzasx/aG䤈POXOJg/ a@XO`Jg / a.XOJgJg$ yA&Jg6Jg2/ /aHzaXJf BA&B`X yA&|`FI//9A2/9A*a0$POXOf//9A2/9A*a~$POXOJfHzeHnazPO/ //./a#A&POPO .g/arBXOHz+`Jg$ yAJg6Jg2/ /aVHzaJf BAB` yA|`I//9A/9Aan$POXOf//9A/9Aa$POXOJf/9Aa"-HXO/ //./a#APOPO .g/aBXOHzapL<|N^NuNVaB9AN^NuNV nJgfB` -f`  bRHJfpN^NunobodyNV/ yA@JgL (gF/aXOJg" yA@/(aG$/a PPOJg `0 yA@/(a $XO fHza $ fpF@$.N^NunogroupNV/ yA@JgN ( gH/a(XOJg" yA@/( aGN$/a >POJg `0 yA@/( a $XO fHza $ fpF@$.N^NuNV/ / &n . g^B/HnE ,pNHx./.aG(POPOJgB/`Hz:Hk NXO.HkaPO .g(/aB`HzHkE ,pNHzHk N$n&nN^NuAuthauthentication scheme:HTAA_parseProtFile: valid%s %s `%s' HTAA_parseProtFile: unknownmaskHTAA_parseProtFile: Mask group: HTAA_parseProtFile: Mask group syntax error HTAA_parseProtFile: Name%s `%s' bound to value `%s' in protection setup file at lineHTAA_parseProtFile: Syntax error%s %s %d (that line ignored) NVH08$n&. JgJgBG TI +/a $XOrg\` /a $XOrgrg@rfHyCHHna/N$POXOrg /a XOHxHz$/.NPOXOJf/N$XOrfHyCHa$XOgPJf a%H//*a^POJA gV/a4/HzHzHzam|/aG䞌`,JA g$HyCHHzHzHzamN/aG^/a $XOrf/a $XOrgrgF`HxHz/.NPOXOJfX/a %@tXOJA gJg"Hzmal/aG/*a#POXO`~Hzlal/aG䝾PO`h/N$XOrfZJf a ^%HHyCH/./*a /N$POPOJA g$HyCH/.Hz5HzJalF/aGV SrdJA g$/9APHz7HzTHzqal/aG/a XOSre` .g /aBL N^NuHTAAProt_new: Protection file%s `%s' already in cache HTAAProt_new: Loading protection file `%s' HTAAProt_new../../../WWW/Library/Implementation/HTAAProt.cr(null)Unable to open protection setup fileHTAAProt_new: %s `%s' NVH08&.$. &yA8Jf a#A8Jg &kJg$SJg0//aG䜢POJfJg&jJA g/HzHz`JA g/Hzajl/aG|POXOHxHxI :N&HPOJfHzHza:POBBBB aV'HBa'HJghHz/aG$HPOJgT/ / an/ aGHxHxN$HJfHzhHzqaPO%KB// ax/ /9A8ad`*JA g& f < /HziHzai/aG䚔POPOJg/Hka*PO/./ a K L N^Nunot specified (obligatory for DefProt rule)!! HTAA_setDefaultProtection: ERROR: Protection file%s %s NV . BADPA`XA`RA"`LA7`FAE`@AR`:AP`4AN`.HyCHHzX` HyCHHzhHyAaGAA`Ah N^NuNVH<< n*n (."DBcTBIA\GE8z0z<z?VKVJVHVbAf|=` Tf |=|=B L</aGN`"9AAeHHx/9A/9AaѾPOXOJnr#A n`#AA yA#AB$yAJg g g n`hB 9Ac&  gRJbAdB * fB*<Jg/9AHna`/9AHna$PORJ#A`& $.$nN^NuHTGroup.c: Syntax error in rule file at line%s %d before: '%s' HTGroup.c: %s (got %s) NV/ /$nB RC$SHJl / aG.XO` jBRrgr gr'm(R`B6(JA g0/.a//. Hn/9APHz2Hz[aRl/aG|RAP$.$nN^NuExpecting a single address or '(' beginning listparse_address_part../../../WWW/Library/Implementation/HTGroup.cExpecting an address templateExpecting ')' closing address listNVH80&.B/G TN$@AXOre<`$rf/N$@XOrgr g / Hz`az$HxHxa<$HPOJfHz Hza"POBBHyCH/ a/ /aPOPOJfh/a$@XOrf4/a$@XOrgArd/ Hz/a/a&`$Jfrg/a/ Hz/a` B L N^NuExpecting a single name or '(' beginning listparse_user_partExpecting user or group nameExpecting ')' closing user/group listNVH< (.B/E TN$XOrf<`rf/N$XOrg /Hz>`a&HxHxa$HPOJfHzFHzaِPOBBHyCH/ a'H/ /9Aa{/ aGtJA g(/ HzaC/aGuPOXOJA g/+aX k LN^NuNVH88 n(n (.&.tJgJg&hJg &kJg$SJgl *g///a POXOJgP g.$@Jg $jJg RJg (g/// /a$POPOfB` JgJg/ /aGu(POJf`t` LN^NuNV/ $nJg, g /aBXO *g/ayVBXO/ a$nN^NuHH|$n4.00*H&0H(0*Hln0*HlbJm\JmVIQ bL ;NJJ @@@NprƒЃ,l>p ./ NrXrf L|N^NuR`  m ~oPI-p A6aIr2./ N$X6bIr2./ NX`JjgjAM%00;Bg> rK%f 5K% `02K%Hl 5K%`02K% Ho 5K% RAM%1 0*HmFvR0*&Ho8J*g* f.N x.N S`p`.N `Slv 5@ 4p`HH $n&n Jg"I./ N Xrf L N^Nup`NqHH$nJnf=||Jnf=|-0*H(0*HS&&ra(r=%t`0.9+7+RmSt`A-%0.1KA-%1QRo.N LN^NuNqHH$nCGRf$yA6.N |pLN^NuH nCGRf1CH(N^Nub`NqHH<$n0H$0*H&0*A-%IxA-%A;*H&M`" S g*Kpf r-% (6 TepgR02+%Hn r+%f 5+%02+% H" -%JjDD`≰l r-% 5+% L<N^NuNqHN ϜN^NuHH$n* f$t`.-%N :R0*HlJ-%f.N :.N :LN^NuHpCHN^NuNqH00CH,H-@JAf1'CH,N д1CH,p.ACH/N 8XJ0A6g. ˌp//0AN LPp.00AHS/N XN #AN .AjNG N^NuHH< $nt`vB*r-%0*A(H&M` S g-Kpf &6 TepgF02+%Hn r+%f 5+% r-% .22+% Hl .5+% R0*Hmlp45@L< N^NuNqHH.ANG $H f$yA.A\/<Aj/ N DP-Hf./9ADN X yA6 LN^NuNqHHp.NG! Jg.A(NG $H f$yA`$yA.A\/<Aj/ NP yA6 LN^NuH.p/N :X#CH! CH!CHN . /.N X-HpAN . p/N X00AH#CH00AH#CHp.//9CH/9CHN #CGRp.//9CH/9CHN^ #A6!CH0!CGRCH4BA n N^NuHp.p//.N $PN^NuHN^NuHHp(.p/N :X$H f LN^Nup5@45n 5n5n5n @@@ J`HH $n$. &.0*Hl 0*Hm pL N^Nu 5@ 4p`NqH.p/N :X#CH! CH!CHpCHN . /.N X-H"f N^NupApAN . p/N XJCGR00AH#CH00AH#CHp.//9CH/9CHN X #CGRp.//9CH/9CHN t #A6!CH0!CGRCH4BA n`4HH $.&. (.*. ЂCHo 9CH$ ЃCHo 9CH&Jf 9CH$Jf 9CH&.///N X $H fL`<~`.}%N :Rm.N :. N :.N :.N : L N^Nu|`4p./N :X%m%g&rm%`6 Am%A;eRm J`NqHCHN^NuHJCHg JCHg.p/N :X#CH! CHJf-|A. N PHn6b I//.N $ JmN Nrf N^Nu!ACH81CH(p.00AHT/N :X!CHp.00AHT/N :X!CHN Ѵ!CHp.p/N :X!CH0BpCHBpCHN yCH`DHJ0Ag#ALAD`JA:ghJ0AfZJ0AfNJANfBA&N p`jNqHH$n0*H&0*HS(t`Br+% 5+% RmLN^NuHH$n f*LN^Nu./. / N(P$H` I. nNJg $f *<f`HH $nt&JTI0 AUg( Ѐ"ЁIЁ0$I0 AUfԂ Ԁ .f2RI0 AUgI0Ԁ`RI0 AUf *fRL.( >f.RJgJ0Af./N tX J L N^NuI. nN K`NqHp.00AHS/N XN ,.AjNG .p/N Xp.NG$ .NG$,p.p/NG!&X.NG$ . p/N XN Ѥ1CH(.CGRN xN^NuHH$n0.F@jpLN^NuNqHH$n0.jpLN^NuH.N N дN^NuNqHH$nBjpLN^NuHH$npLN^NuNqHp.N p.N ɰCH00AHS.p/00AHS/p/N ` N μ. ˌp//0AN LP. ˌp//0AfN LPN^NuNqHH<$.p00A*ope pLp./0A.N X1CH@p./0A>N X1CHBp./0A&N X1CHDp./0A^N X1CHFp./0AjN X1CHH1CHJp./0ARN X1CHLp./0ArN X1CHNp.p //0AN ,P/N X1CHPp.p //0AN ,P/N X1CHRp.p //0AN ,P/N X1CHTp.p //0AN ,P/N X1CHVp.p //0AFN ,P/N X1CHXp.p//0A"N ,P/N X1CHZLN^NuNqH .20CH|HgJg. ˌp//0A`N^Nu. ˌp//0AN LP1 CH|`HH<$.&. R*JpCHmb00CHHR pCH$p  gB0* pCHl200CHpAm 00A` 00CHH5@ 1CH 1CHJmJm pCHJ]g p]"pCH]fRN L$H pCHJ]g,00] H(5@ &j pCH(p] `6SJn pCH!] pCH$p]B`0* Rj 5 % 0* Hm pCH p] A;!CHL/.N -HJAg pA` |A./< /0AB/.ND -HJAg pA` |A./</0AF/.N -HJAg pA` |A./</0AJ/.N -HJAg pA` |A./</0AN/.N~ -HJAg pA` |A./</0AR/.N< -H.A/<H/0A/N -H.A/<I/0A^/N -H.A/<J/0A/N -H.A/<K/0AZ/N -H.A/<L/0A/N~ -H.A/<M/0A /NX -H.A/<N/0A&/N2 -H.A/<O/0A"/N -H.A/<P/0Av/N -H.A/<Q/0Az/N -H.A/<R/0Aj/N -H.A/<S/0An/Nt -H.A/<T/0A~/NN -H.A/<U/0A/N( -H.A/<V/0A/N -H.A/<[/0Af/N -H.A/<\/0AR/N -H.A/<]/0AV/N -H.A/<^/0AZ/Nj -H.A/<_/0A^/ND -H.A /<`/0Ab/N -HBvb n N^NuHJ g6./.NG!X. HvbNG!X=b " n N^NuNqHH$pCH g!CH `0p.p/N :X$Hp.00AH/N :X%H Bj B J LN^NuHHBCK~JpCH.m$.CK/<@f00CH.H/NG!P`BCKJCKg pLN^NuJpCHmx00CHHR pCH00  pCHlL00CHpAm 00A` 00CHH pCH20CHHR1 t`p pCH$p- pCH&p- g&g"0* H&gI;% 0$ @ fSn 5@ g"0+ H&gI;% 0$ @ fSn 7@ R00AHoJpAoN(00CH*H `1CH,JpCH(gfN BpCH(t`B pCH p-"pCH-g pCH.-N l pCHB-R00AHoJg| CH`ljt`p pCHJ-fN L"pCH#- pCHJ-f"pCH!--` pCH.-N pCH.-N R00AHovt(`F R pCH 0  pCH=fR pCH 0= pCH=fRR00AHm00AHWofo`00AHS.p/00AHS/p/N ` p.N  pCH.N lv` R pCH p  R"pCH fN L-H R pCH00  H-@=b R pCH- a-vb R pCH-p  ` nT"nT0SJn R pCH!  pCH R"H! =R00AHmN L(H00A pCH!v`R`00AHS.p/00AHS/p/N ` N pt` pCH p-"pCH-gn S. pCH/0- I/0-N xP pCH p-"pCH-g pCH.-N l pCH"pCH!--R00AHobJCKg00CHH-@00CHH-@00AHS.00AHS/N X00A pCH p 00AHS1 BCK./.N Xp.N N JCKf00AHS.p/ S/ S/N ` N p./N |X R&`HH t`^ pCH$p- gH pCH-g80* H(&j v`$p03;g.// N P5@ `RmR00AHoL N^NuNqHp.00AHS/N XN ,.AjNG p.p/NG!&X. p/N XN 1CH(p.N ٸN^NuNqHH|&.(.*.,. Jo6Jo2CHn*CHo ` .N :`p(.p/N :X$H f L|N^Nup./N :X%Hgp./N :X%Hf.N :.N :p./N :X%H f.N :.N :.N :p5@4CHf CHfp`p@ 5@ 5@ 5@ 5@ p@@@Bj$ S@5@&t`p5+% 5+%Rm ІCHfN CHf"CHfJfJfJA*g ЅCHfJ0Ag J`NqH .f . g0Afp`N^Nup#AJfn .".Rf^JA.gRJARgFJ o(JA.g. ˌp//0A.N LP. ˌp//0AR`.p//./N -@.p//./. N -@p././. N8P-@.p//./N -@.p//./.N z -@p././.N P-@00CHHЮЮ-@ .l. . l .` .Ю-@00CH@HЮ`R . l .` .Ю-@ mp.//./.N -@00CH@HЮЮ-@ .䰮n@n:n4. ˌp//././0ANN , /N L` .ذnn . oL .o.p//./.N  `p././.NP.p//./. ` .o.p//./.N `p././.N@Pp././. N,P`& .ܰnl. ˌp//0A.N LP .op.p//./.`^p././.NP.p//.p/NF `. ˌp//0AVN LP.p//.p/N `HHJCHgCHrg `p-@ . l <LN^Nu . fp`Jg1CHH`1CHJCHH . XJjDD`-@20AHm"00AHSJjDD`-@ .萮^JjDD`-@Jn-n .谮 l4 . -@00CHBH".L00CHHHL.`2 .萮 -@00CHBH".L00CHFHL.Ҁ-A . 20CHHHL-@JAg00CHRH-@`-|JAFg00CHXH-@`-| .nDn>n8Jg*. ˌp//. /0AFN ,P/N LP .`& .nDn>Jg0. ˌp/ . //0AN ,P/N LP .`Jg .l2B` . ˌp//0A>N LPR .찮m .谮 lB .찮l .R pCH$p JAjgNJg* gD .Юr22 % p00CH$g. ˌp//0AjN LP`: g,0* H".Ү찁o .Юr22 % .`p .N ˌR`FB` . ˌp//0A^N LPR .찮m`-n` .R pCH$p JAjgJJg& g@ .r22 % p00CH$g. ˌp//0AjN LP`0 g"0* Ho .r22 % .`p .N ˌR .찮 mX .m .`H . o <N^Nu . fp`JA^gJA&g . XJjDD`-@ l-| .^JjDD`-@Jn-n .찮 l: . -@00CHDH".L00CHHHL.Ҁ-A`` .쐮 -@00CHDH".L00CHFHL.Ҁ-A`& . 20CHFHL-@`-|JAg00CHPH-@`-|JAFg00CHXH-@`-| .n>n8Jg*. ˌp//. /0AFN ,P/N LP .`L .n>Jg0. ˌp/ . //0AN ,P/N LP .`JgJA&gB` . ˌp//0A&N LPR .m .찮 l2B .l. ˌp//0AjN LPR`B` . ˌp//0A^N LPR .m`2-n` . ˌp//0A^N LPS . n .`H . o <N^Nu . fp`JArg . 20CHNHL-@`-|JAg00CHTH-@`-|JA"g00CHZH-@`-| .n>n8Jg*. ˌp//. /0A"N ,P/N LP .`* .n>Jg0. ˌp/ . //0AN ,P/N LP .`Jg2-n` . ˌp//0ArN LPS . n .`H . l <N^Nu . fp`JARgn8Jg*. ˌp//. /0A"N ,P/N LP .` .n>Jg0. ˌp/ . //0AN ,P/N LP .`Jg2-n` . ˌp//0ARN LPR . m .`HHH LBl$n&|ABdB`Jf .A`hB9A"` `p mpdl4`| Jg$ g fJdg pAR`&<`p pAj-H\Jdg0 g,00AHSlJArgT-pAr\J\g$ nANf.\/<A"NG!XS  .lSlJ p`D .lSl-v p\.\NG!` .lSl-v p\J6a\g n\R\`R R`I$1 b ;NJ &:NbtRl .l- p`Rl .l- p`Rl .l- p`nRl .l- p`ZRl .l- p`FRl .l- p`4Rl .l-$ p`"Rl .l-( p`Rl .l-, pp1fp` .A=`Jp-@d`Ia".lSl- p `Rl .lIa- p`Rl .lI- p 'g.AM`v-|h -f -|h` +fR` Ѐ"ЁЂ0&I$p0mp9op}g .Ac`Rl .l".hL`( .lSl$6 p .lSl&6 pRl .l"҂- p` .lSl$6 p .lSl&6 pRl .l"` .lSl$6 p .lSl&6 pRl .l"L` .lSl$6 p .lSl&6 pRl .l"LB`r .lSl$6 p .lSl&6 p rLBRl .l`B .lSl$6 p .lSl&6 pRl .l"‚` .lSl$6 p .lSl&6 pRl .l"` .lSl$6 p .lSl&6 pRl .l"` .lSl$6 p .lSl&6 pfFp`D .lSl$6 p .lSl&6 pn` .lSl$6 p .lSl&6 pmpRl` .lJ pfp`p".l- p`4 .l""6 pF` .lSlJ pfpe`p;./ NX$HI$g p%f .l&6 p 0f -|`RI$! ]b ;NJ^`n8p>~.Ay`4.A"/ NG!X |A L LN^Nup3f dg .ANZ` d0 rL|d&pdlp2f dg.A+`  0 rL| 0` H N^NuHH $nt`6 %f0.g ;fJf J L N^Nu ?fR ;fSf.AN`HH $nJ*fCGRg JpCH(g 1CH(B*CGRg.N CGRfp.N ٸ`t` r+%gz0*HЂ&0*HSA-%I &r-%0* H./N X` pCHTCH0b 00CHRpCHpAm5+%R0*Hmp#CKzpL N^NuNqH.CHNG N^NuNqHHJpCH$g*p00CH"$BpCH"N  1CH"LN^NuHH$n g$Jf t&j 0* A% (HUc T g` LN^NuTb S g R@5@` Ѐr2Ё$c$Jf${`NqHH<$n&n g g(j 0* A% -H`L<N^Nu(|A-L g*k 0+ A% -H` *|A-Mp-@-@-@-@U n P fdU n P fd .".⁰fp`p-@`TR T fc U fbTR`JgT` UUR06avaf bc0Uf^bVbNTTR`TTR0Uf bc06avafbbUUR` .R-@ .R-@JfJf .谮g-n-n .찮o` .谮o L0CHlаCHpѮ .ܰo` .ذo L0CHlаCHpѮ .찮g .Ѯ .Ю".Үذg .Ѯ .ȰoD .ЮѮ .ЮѮ .ЀѮ .ЀѮ .Ѐ .ЀBBJpAmBJo< v bf0p06ag v bfTTRRSJfJfJflJfd`2././ .谮m .//.N p .Ю".Үܰl .Ю./.N XN `JfJ0A f-n .萮-@JoЀ .Ѯ-n`Jl .Ѐ .-nB-n-L-M`2 v af v agR06avafRTT nb ncJA>gJ0A f .̰lJo2./.N XN -L` = aT nc././ /./.N p`JfJfJg .Ю".Үܐ-@ .萮-@JoЀ .Ѯ-n`Jl .Ѐ .-nJmd. n .Ѐ// /./.N pJo. n .ЀHh .Юؐ//.N< `././ /./.N p .D.N &` .谮l\p./.N X .쐮-@.N &-n0* H-@B`"22% n5 % R .mJfJf8Jf2` .ЮЮ./.N X .ܐ.N &`././ .Ю//.N p .ذl .ЮЮ./.N XN `Jo>Jo8 .ذm .-@.A Hh/ .Ю//.N p .ذm2 .ذo(. .Hu  .ЮЮ//.N .谮o.p//.NPN @`H. /.N X o$JAg.N p.N TN^Nup.N T.N $0`H n .R-@. /.N X oJAg .N ` p.N Tp./././. /.N pp.N TN^NuHJAg4CHf(. ˌp//0AN LPpCHJAgT oJ. ˌ/././0AN ,P/N LPN^Nu. ˌp//0AN LPSm`NqH .CHN^NuHH $nx gt00AH&$ pCHG=` fRSYJn$ pCHA=&H` fRSYJnpn%pCH $!CH L N^NuH. ˌp//0AN LP. ˌp//0AvN LP. ˌp//0AN LP. ˌp//0A:N LPBpCHBpCHpCHCH1CH1CHBpCH00AS@1CHBpCH~N pN^NuHHJA*gN pp.00CHH/N Xt`. ˌp//0A*N LPRm0. pCH~00CH~H20AHЁ20AHo00ApA1CH~LN^Nup./N X.N '`H00CH$pCH"gN. ˌp00CH"/N X1CH"CH$JpAm00ApCHN^NuNqHCHCH氁g&. ˌp/CHrf pA`N^Nu pA/N LPCH"CH`HH$n$. &.|00CHH.BB(*`p02KgRp02Kr f R02 @@ 1KA.`P Sr22 p f S22KAA 1 A.` R22KAA 1 A.lRp02K, R"R1 A.mJJgl00AHo00AH* Sr20 A.g 00AHlR S1 A.x` 5KA.KRm$Jg 00CHHRf0.pCH LN^NuHSpCH,l|JCKfr pCH"H (roVN JpCH.m$.CK/<@f00CH.H/NG!P`BCK00CH*H `1CH,N^NuNqHHJ0AfN JA>g>. ˌ00AH20CHH//0A>N LPLN^NuJA~g,JAg JpCHfp.N 'p.Nl`00CHHR pCH$p 00CHHR$0* Hl r +% g".00CHH/N Xp.N $0R`HHJ0AfJpCH$gN 00CHHЮ20AHmg(J0A g. ˌp//0A>N LPS`vJAgx n pAJf^. ˌ00AH20CHH/00CHH//./0AN , /N LPLN^NuJA2gB pAJf2. ˌp//0A&N LP. ˌp/00CHH/00CHH//0A2N , /N LP. ˌp//0AN LP$.`. ˌp//0A.N LPSJn. ˌp/00CHH/00CHH//0A2N , /N LP. ˌp//0AN LP1CHCH1CHCH`. ˌ00AH20CHH//0AN LP .S$Joh. ˌ00AH20CHH//0AN LPS`NqHH$.&. Bx`pO O I-O R m(`,Hn pCH/0MN:P.R6 D@=K Ro(`4Hn pCH/0MNP.R6 = D@=K Ro(`:06K HD. 6 f" 6 f= K 06K "= Ro S"SA= S= R"RA= R= (`RJvK oH RJv n<06K H* R06 "Rv f R"RA= R"RA= Ro(`RJvK oH SJv n<06K H* S06 "Sv f S"SA= S"SA= Sl(`R vK lF06K HD 6 o206K H*,` 06k Hf =K =k `RmRo|.(`@JvK o 06K Hl pCH00MH܀06K Ho 06K H.RoJoZz R.(`HJvK o 06K Ho pCH00MHڀJvK o06K Hl 06K H.Sl`zlN~(`BJvK o"06K Hl06K = =K 06K Ho 06K H.Ro`X R.(`JJvK o"06K Ho06K = =K JvK o06K Hl 06K H.SlB-n|*(`~06K vK g pCHJMgJpM f pCH00MH܀` pCHJMgJpM fT` pCH00M H pCH20M H.o܇` D܀ pCH00M H. pCH$pM JG{ pCH pM I{`0dgRUdJvK n pCH00MHڀ`|06K H.o,00AH"0CH\LҰCH` `.Jl8 D20AHL0CH\ҰCH`Lڀ߮߮Rom(nZp=K =K R`Jl@ .D-@00CHHm&p. /N X .Ѯ.N ' S,B(`,JvK o 06K H26k H".o 20CHHRf .N `p. S/N X.N '߮߮ *`XJv[ o06[ Jv o"v pCH.]N l pCH Ї"H! ] Ї= [ R onLJv[ o06[ Jv o"v pCH.]N l pCHB]=[ R`,RoN @Jf JCKf*`RJv[ o(nֺn RJv[ oJvK l06[ Hg .Єo00CHHRlp. S/N X ..N N @JfJCKfT,`JJvk o vk pCH.mN l pCH "H! m = k Sl`DLN^NuJvk o vk pCH.mN l pCHBmBvk SlJCKfx S. pCH/0M pCH/0MN xP pCH pM"pCHMg pCH.MN l pCH"pCH!MMR`ZHH$n (< .$`$R mtSn.A/<AN X&2/gf%/ LN^NuHH< t 00CH"-@ n .20AHoN .00AHS/N X n .././/<A/<AxNG N >Jg-vb . I %`$nA-H`Vp0gR gp0gR R fG0 @ f0 @ f S fR nRp*TcS-n -nJgR-vb 06b H-@$n .I %`"0TfGKMf Mf0UfRTTc`BBJf4./.N Xp.N .HnN !tXL< N^Nu np0(-@ .A %-H$n .I %A-H`p0-@ .-@p0*-@JpAm .ذgp`p-@J0Amp0gp`p-@̹e -| `p0-@p0f:CHrg*Jf$JfJ0A g: .A %ȹe*./.N XJ0AgJf .gN +.N .gRJpAmFN 00AHЀ00AHЀ00AHѮ00AHѮJpAm 6 agFGK`Uf"TTb0SfJA geU &A9%-H`v-n./.N !tX׮׮ Ѐ Ѐ-nRTTR ncJpAmJgp.N N `H-yA@JfJAfJA2g. p/ ./ .@/ . / ./ ./ ./ ./ ./ .//0A2N ,(/N LP-n` 9A@~".~oJAg. p//0A`* A@f(JAg. p//0AN LP` JAg. p//0A`BA@-yA@. g*9ABf . p//0AN LP. f,9ABg". p//0AN LP. g*9ABf . p//0AN LP. g*9ABf . p//0AN LP. g69ABf,JAg . p//0AN LP. g69ABf,JAg . p//0AN LP. g69ABf,JAg . p//0AN LP. g69ABf,JAg . p//0AN LP. g69ABf,JAg . p//0AN LP. f,9ABg". p//0AN LP. g69ACf,JAg . p//0AN LP. f9ACg. p//0AN LP`zJAg. p//0A`* A@f(JAg. p//0AN LP` JAg. p//0A`B .g2 .g(.f . p//0AN LP#A@N^NuHH$n&n N 8N `Ht`Rbg pCH`SSSpCH00CHH20AHSm J0Af. ˌ//I//0A N , /N LPA$H*fR`I$CHrf@JAg4. ˌ00AH20CHH//0AN LPJ0AgHJ0Agg g JABg. ˌ/./0AB`>JA*g00CHpCHfN p$.`Bp.00CHH/N X. ˌp//0A*N LPRpCH~SJn00CH~H20AHЁ20AHo00ApA1CH~LN^NuJAgr n pA~JfX. ˌ00AH20CHH/00CHH//./0AN , /N LP`zJA2gb pA~JfR. ˌp//0A&N LP. ˌp/00CHH/00CHH//0A2N , /N LP. ˌp/p/00CHH//0ANN , /N LPt`. ˌp//0A*N LPRm. ˌp/00CHH/00CHH//0A2N , /N LP. ˌp//0AN LP1CHCH1CHCH` tl. ˌ00AH20CHH//0A~N LPR`NqH1CH$N N^NuNV/ ECKJg ZNJf$nN^NuNV/ / 9CKrfBACKJgXHRJfJgGCKE RNYJf$n&nN^NuNVJA.f p#A.aN^NuNV/$.alaGBa/aG&NqNVN^NuHHJ gJ6a f: .. ApNG -H f.A'NG -H gJ6a f-|A, .. A/. NG!XJgrJfTp%./. NG!X g>I./. / NG!P-|`DJg0 .f|`V&TAxd&9AxB0zle&0z`e0zVUID`00zJre&r`"0zBe0z8rer` 0z.rerAl"9Act$9AY  @A||m*"XRJgf"i *cB"ig*bbжc,/aJf| #G ,`"9AAA|"p*`JoS(Axe0ze&0zve0zlUID`00z`te&t`"0zXe0zNtet` 0zDtetg if0AA|BAf:|Am0RA 9AJ f`$i%H!JAA|f!GA| s,Jf$I I',Al #A`$h#H!I%I#J  I!D"`V if0AA|BAf:|Am0RA 9AJ f`$i%H!JAA|f!&  IXH !< L |N^NuNVH80 .vJgX$@ <Jm x#G ,`@$GE,Cfh C 0zαe&0z±e0zUID`00zve&v`"0ze0zvev` 0zvevԑ  I"!B$IJmԓ0zde&0zXe0zNUID`00zBre&r`"0z:e0z0rer` 0z&rer kf0AA|BAf:xAm0RA 9AJ f`"k#H!IAA|f!  J$!B0ze&0ze0zUID`00zre&r`"0ze0z~rer` 0ztrergJmT jf0AA|B<Af:xAm0RA 9AJ f`"j#H!IAA|<f!<GA| sJf"J J'Al #A`"h%H!J#J%I  J!B$#AAA|!L N^NuNVH><*n". Jf /a`Jf / af`v V(TAxd(9AxI$<Jm|#G ,`B&<*ʃb2"Axe$ ()LIL ()Hla`E\ fc0/aR$XOg &@Hk/ /aGvPO.a B` E 0ze&0ze0zUID`00zre&r`"0ze0zrer` 0z|rer&Axe0z\e&0zPe0zFUID`00z:te&t`"0z2e0z(tet` 0ztetg jf0AA|BAf:|Am0RA 9AJ f`"j#H!IAA|f! <A|&@ s,Jf"J J',Al #A`"h%H!J#J%I  J!C$`V jf0AA|BAf:|Am0RA 9AJ f`"j#H!IAA|f!(ڄ )\( M L<|N^NuNV//&.L.8 /aD$XOg /B/aGx B $.&.N^NuNV/.aN^NuNVH00&.&n CBJg =gRHRJf$y@Jg4///aGPOXOJf B =f @&RH`XJJf̑ L N^NuNVH8<(n&n =fRK/ KG!N&Hn/ ab$HPOXOJgJg/ NXObf`$y@BJgXJRJfJA:g& "@Hi/9@a#@POfDp`x#A: "@Hia$HXOJg // /9@a>#@POXO y@B,-B$LJg =gRJJf JHp8a" . y@! g|$A` =gRJf=fBL<N^NuNV/$.Hn/a @$.N^NuNV0| N^NuNV# =A#ABN^NuHRA AfNG p.NG!/NG!&XN^NuNqHH<$nA-Htv 0fvR xg Xfv`$.`> .".`$ .".ቀ".$ LL N^NuHH .Ѐ-@ .S".LA% `D  Ln".LE% ./. nNX$f J LN^NuJl J-H` A%-H n d`H././. NG!JPN^NuH./. /.NG!DPN^Nu"/ /g~Ҁ Ag B Sgh"g8H~/"| B:L|"@H~H~H~H~HSn"L~"g BYnJg B SnNuNqHN^NuNqHp6cAUN^NuHp6cAUN^NuHp6cAU N^NuHp6cAUN^NuHp6cAUN^NuHp6cAUN^NuHp6cAUWN^NuHp6cAUN^NuHp6cAUN^NuHp6cAUN^NuHp6cAUN^NuHpfpN^Nup`HpN^NuH.NJg p ЮN^Nu .`H.NJg . N^Nu .`Hp ЮN^NuH . N^NuH f6J9CLg-| dcCLcATR`Jg`J9CLf*-|`cATcCLR e-|` .S %cATR e |AU N^NuH.@/. /.NG"@PN^NuHH $n NG &H g@BB+ n + I'H'H! A&`I ag& rg wg* L N^Nu `p.p//.NG!2P *+f + + K`HJ n #G ,` Jf". N 3 -Hf# G , N^NuBG ,.A20/<A2,N X-Hg./. /.NG P.N p./.NG!X-H ( g#"G ,` nB( n`H.NG"rf N^NuJ g.A28NG -H A24gp2.//9A24NG!PJg4JfBA24` p2././<AFNG!P#AFA24N 8 9A6|L|<-a -A6b p`hNqHJAzf.^p/N :X#Az yAz N^NuHH$.N$HN gtJf,`j.HnHnN ~PJgN\ n LN^Nu./<HnNG P g"HnNG!X.HnNX-Hf`N `HH $nN&&H gxNxJf,`j.HnHnNPJgN n L N^Nu./<HnNG P g"HnNG!X.HnNX-Hf`Nv`HHN$H g,Jf.N Jf$.A2O/9A2@NG X%H`LN^Nu.N Jg .N 5BN`HHN$$H g,Jg.NG BJg .N 5BNFLN^NuH./<HnNG P f N^NuHnNG!X.HnNX`HH$n$. `RJgIg  f  fB`JgB J LN^NuHHnHnp/N N^NuHHN,$HBa Ba f*`^N.N#A~Jf-Ha`8Jf.N Jf.A2Q/9A2@NG X%Hf`.A~/*/*NPP-H.N 5JgN`v +g -fd vaHhNX`l-a .A2S/6aNG!XJg,.N#A~. vaHhN~X-H"f`.N.Jf n LN^NuJf8./<HnNG P gHnNG!X.HnNX-Hf`.I`$HHN$H g. /.Hj\NG!PG\ .  \A\A& B +fp`p$%KLp:./ NX&H%KPp:./ NX&H :fJg$p .Hn/ N P-@&n :gJf LN^Nu%nTA(%HXp ./ N8XI(`ADd(p,./ NX&HJfBAL`HH$yAz g2-jH` .aN 5.N 5-vbJfBHLN^NuHH$yAz g. /.NX-Hf LN^NuJbg vbJg-bJb g vb Jg-b n`HH $yAz g2&va-jHJg ./6aNG!XJfpL N^Nup`-vb`HH$yAzB gRHjHjHnHn/*$/* /<A2U/N  -@gBJ g . N 5%n %n$LN^NuHH$yAzB gJHjHjHnHn/<A2b/N Ũ-@gBJ g . N 5%n %n$LN^NuHH$yAz gVHnHn/.NG!X//./<A2o/N о-@f"./.NX-H.N 5Jf LN^NuJb g vb Jg-bJb g vb Jg-b n`HH$yAz gLp.N 3 -H.NG!R.N 3 -H./NG!X-a-Hb%nHLN^NuHH$yAz f LN^NuJAgR-pA `.aN 5XJaf.AN 5.A N 5.AN 5p.N 3 #A.bNG!R.N 3 !A.b/NG!XA-H-vb `@ nCd<.aNG!R.N 3 -a.a/NG!XXXJafBaA .ؐR-@.N 3 !A ./HnN AtP yA`HH$yAz-va g6aI +g8 -f. vaHhNG!XJfBa pLN^Nu.A2|/6aNG!XJf.N-H./.`2. vaHhNG!XJfH.N-H. vaHhNX-H"g"-a `./6aNG!XJghp`dHH$yAz-va g6aI +g6 -f vaHhNX".fBa pLN^Nu.A2~/6aNG!XJf(.N-H./.NX-H"gN-a `.N-H. vaHhNX-H"g 6bg` 6bgpp`lHH$yAz f pLN^NuHj/.NXP-H"g 6b` <`HH$yAz gn./<A2HnNG!PHnHnHnNG!X/Hn/<A2/N о-@f"./.NX-H.N 5Jf LN^NuJb g vb Jg-bJb g vb Jg-b n`NqHH$yA f(.p/N :X @$H#AHjN X J LN^NuHHN$H-| . A %-H&np0+-@p0+-@-|A-|Ab (HJg\Jg././ /./.N $l #CH`H X%n.NG!R$ծ`DJgDAg #CH` #CH LN^Nu./ N lXXSnA-HA%HA-HA%HB` nX .NG!R$ծ`Jg6 f,././ /./.N $m0%n`LJf fJgf .찮g@`%B-n fp`p%@Jf%n.NG!RѮp".ѮA)%Aŏd. nX"n / / N AtPծRSmdz././ /./.N $mV.N Tr2-AT.N Tr2-A\.N Tr2$T f nC\en`zJg BaBaA`HH6aI0 AUg@$nJf ".g2#CH LN^NuI0 AUf .fR`.Hnp///.N >-@mp./.HnNP-Hf .N"` n`HH N$H f6aI.6bI/6bI/6bI//<A2HnNG!.Hnp /p/HnN -@Jmp./.HnNP&H f./. /.N>P&H f L N^Nu'n'n %|AB#aA K`HH $. &.N$HB#CH f L N^Nu%|A2p.NJgD.aN d-HHnHn/NG!X//./*/*N о-@Jg#CHp.N`"./.NX&H.N 5BCH`@%@`%|%|`R  g  g%KA%H(H.A2`B`"R`A\d(.A2/ NX&H f gJg  g  f`B-|JgGbJf`R  g  g  g-K.A2/ NfX&H gT-K  g.A2/ NHX-HB .A`A % .N >@".%`R .B `jA`HH $n`"&n `f J L N^NuRJfRfڑ`pJ o"/NOeNuNG fHH$yAŖ f6.2p/N :X @$H f LN^Nu%|A3f#AŖ yAŖ`HH $nN&HB gTNJ$f`Dp.HnHnNG!PB.HnNX./</<A3 p&/N Bp .HnNG!X f.$/<HnNG P f`HnHnNG!X/HnNb -Hf ./<A3A`HHn/ HnHnNJgJCQ"fNf n L N^NuJg./<A3Np&/N PB.$/<HnNG P gp .HnNG!X fH`JCQ"fN`HH$.N"$HB gVNXJ$f `Fp.HnHnNG!PB.HnNXHn/</<A3[p&/N Bp .HnNG!X f.$/<HnNG P f`HnHnNG!X/HnN -Hf ./<A3`HHn/HnHnNJgJCQ"fN n LN^NuJg./<A3p&/N PB.$/<HnNG P gp .HnNG!X fH`JCQ"fN|`HHN$H g0Jbf HjbN XJ$f".A3/*fNG X%H$`LN^Nu.$N J(g .(N 5B(N`HHN8$H g2J$g.$NG B$J(g .(N 5B(NTN LN^NuHHN$H f pLN^Nu%nfp`HH$n`RJg :g  f :fB J LN^NuHHN$HB g$Jbf HjbN XJ$f.A3/*fNG X%H$f`J(g@Hn/9AŚ/*,/*(N -HNJfJg./<A3`dHnHnHnN t JgZJgHn/9AŚ/.Nv -H"g .NJgJgd./<A3p&/N PB`FN .$/<HnNG P gp .HnNG!X f|p.HnHnNG!PB.HnNdXHn/</<A3p&/N Bp .HnNG!X f.$/<HnNG P f`HnHnNG!X/HnN . -Hf./<A3`.I +gL -f .@fv.b/<A4/ vaHhN t Jg LN^Nu.A4/6aNG!XJfNh.N ,#AŚ` .@fT.N #AŚ.b/<A4 / vaHhN t JgN` vaHhN pX`|.N #AŚHn/ vaHhNJ -H"g .N JgJf8Jg0./<A4 p&/N PB` vaHhN pX`Jg.N HnHnHnN t JfN ` vaHhN X`.N >Jf n`HHN$H-va gN6aI +gR -f 6@bf.b/./ vaHhN t JgBa pLN^Nu.A4/6aNG!XJg4 6@bf@.b/./ vaHhN t Jg.N -H.//.`8. vaHhNG!XJfl.N -H./ vaHhNnP-H"g@-a `B. vaHhNG!XJg `./6aNG!XJg p`HHN\$H-va g6aI +gx -f 6@bff vaHhHnNG!P./ /.NP-H"gf.b/6a/HnN t JgBBa `.A4/6aNG!XJf0.N-H.//.NHP-H"g-a `x 6@bfv vaHhHnNG!P.N\-H.//.NP-H"g.b/6a/HnN t Jg-a pLN^Nu.N-H./ vaHhNP-H"gB 6bg<`0. vaHhN&X".g` 6bgp`HHNx$H f pLN^Nu. / /.N P-H"g 6b` <`HHN,$HB gVHj,Hj(HnHn/*4/*0/<A4/*bN  -@JgB(J0g .0N 5%n0%n4LN^NuHHN$HB gNHj,Hj(HnHn/<A4-/*bN Ũ-@JgB(J0g .0N 5%n0%n4LN^NuHHN@$H g`HnHn/.NG!X//./<A4;/*bN о-@Jf&././.NfP-H.N 5Jf LN^NuJb g vb Jg-bJb g vb Jg-bJb g vb Jg-bJb g vb Jg-b n`vHHN<$H gv./<A4IHnNG!PHnHnHnNG!X/Hn/<A4L/*bN о-@Jf&././.NLP-H.N 5Jf LN^NuJb g vb Jg-bJb g vb Jg-bJb g vb Jg-bJb g vb Jg-b n`vH./. /.NP-Hf N^NuJbg vbJg-bJbg vbJg-bJbg vbJg-bJb g vb Jg-b n`|HHN|$HB gl. /.Hj`NG!PG` .  `A`A& B +fp`p$B(K`I0 AUf -|` RJg :f%Kv` Ѐ"ЁI0Ё&nRgI0 AUf̶l L N^Nu-a J`HH$np.p/Hn/ Nf $H gt .L<-a :frRp;.p/Hn/ N* $H g8 ."逐Ѷa :f8Rp;.p/Hn/ N $H f LN^Nu .Ѷa J`HH$n -ft`I0 AUf +ft. / NX$H f LN^NuJg 6a D-a J`HH$n 6JafBR.mp` 6Mafv$Rp .p/Hj /.N -H"g nR .fxp.p/Hj/.N -H"gT nR .fFp.` 6aI0 AUg,$.mp/Hj/.N -HJf LN^Nu 6/afRHj/.NP-H`%|  n`HH$n . j DD`f . rL|dJf . rL|Jfp`p$ Jgt g f~&.x`$ "ЀЁ |A6A  0ML<QրR * Smp Ъ rL| R-A  nN . S`J *SL<QЮ&Jg <mQ` *L<QЮ&` . -@L|d-@ .rL|d-A .L<UL| RЁJjDD`Ё".jDD`Ё".ҁrL|-AJl^ *-@Jl^x`, "ЀЁ |A6A  * S".^ l ^Rm .L<Qր ЪЮLN^NuHH<$n -nJg&.NG!-@Ѯ 3e*-|2` .N-H -@ mJ6afB`Hn/.NP-H"g./<A7N6X$gBJ6ag(-n.N8-H -@ mHJ6ag. 6,ag$ 6;agHn/.NxP-H"f` .-@ 6,ag 6;afdRHn/.NP-Hg nR ,fHn/.NzP-HgJ6af%|%| rn .D%@J%|N .R%@R .D%@ZB^BbGA(Hx&< n.Hn//N -@.Hn//N -@ .o&&B`&B& j DD`f rL|dJf rL|Jfp`p 0 A6L<Q؀R`FJ6afJf|BBBBv` AJJgX-n  2 JЮ-@Jg .԰f, ".D% J AJ".R!-|`N-n  2 JЮ-@Jg .԰f ".D% J AJB-|RmDJgJgBv`@p29 AJA -HJgJb f .` .Ѳ<-vbRm`"B%|B .D%@JBNBR .R%@ Jg .RѪ 3 c pL<N^NuKJ././ NG!PBJg././ NG!PA%Bp`H./<A6pNXXJgp././<A6pNxPN^NuH#A.AŢ/NXJg .AŢNNbN^NuHH.A7!NG $H fNLN^Nu#AJf.BAŢBAŦBABA.A6p/<ANG!X`@.AŢ/ NXJg. :gp./<AŢ/ NPJgp./<AŢ/ NPN`tHH -vaJAfN2$|AŢJg .llt AJJg Rmt AJG ./ /HnN +-b #A6AJA%! A6tL N^Nut` .,mRm Sr2 $`H.Ap//.N P |A N^NuHJAf#A.A޲N./<A޲/. /.N2 N^NuH.Ap//.NP |A N^NuHH<$n&n|.-RSmF .A~I 6am䰔f(JfJnA~ .S",op`p.,, 6aL|Q$ 6arL|Q& . ր`QSJm Qm QR` L|'@ rL|& L|<'@ rL|<&JgR XrL|'AJl^(<Jm` j DD`f rL|dJf rL|Jfp`p*]A6mfR ]A6$`S j DD`f rL|dJf rL|Jfp`p* а]A6$Jm l'@'B "ЀЁ |A6A *HB` "+$R + l R'@ B LlJlp<.HnHnNtPp<.HnHnNbPp.HnHnNPPp .HnHnN>PJn gtS .lJj DD`f .lrL|dJf .lrL|Jfp`p |A6A  Ѯ`| .lJj DD`f .lrL|dJf .lrL|Jfp`p"ЀЁ |A6A  .A ( .ఄo R mrBR`f,.Bv-|` R .Ѐ-@JnJlp`p-@`S`Jo p稑`pѮHn/.Hn n N HnHnNP$g SJmJl`Jm .аg f |AŢ` |A޲$Hxl AJ 0fz` AJ 0g ."в J"鉐 J-@Hn/.Hn n N HnHnNPJfD .аf:-nݮ./.Hn n NP-a .L|N^Nup`RmZR`2HH b nHn/./. /.N$JfJb m f |AŢ` |A޲$Hvl` AJ 0b fx` AJ 0b g  2 J"鉐 JѶaJb fp`pLN^Nup-b Hn/./. /.N$Jg `  2 J"鉐 JaJb fp`p-b RmJR`Hp./< /.NPN^NuNqHHE*I.*I/*I/I//<A7(/<ANG! |A LN^NuHHEJg,J6ag$$.NG!%@P$A78%|PJG ,m^ 9G ,A*lN p A(h$.NG!%@P$A7I%|A R.Hnp/NG$PLN^Nu |A7;`HHHnNG#$XJm 6ra f .` .$ 6ra f .` .&NG"X(f$|A&`Jg A&.NG ~XAve 6ra fp`p-@.NG ~.NG ~.p//NG P.NG ~p././<A7[/<A7X/<A7PN Pp.NG!pf LN^Nu!-A&.NG ~. /N EX`HH 6b I$.NG .p/N X-H.p/N X-H.p/N X-HHnNG$X&-A&gpfpf-@.p/N X.p/N X.p/N XB-A& .L N^NuHH.N$l DR$JA7dg( ./9@N 8X-H"f>pLN^NuRA7d .N 3 -H"g ./9@/.NG!JP#@ U! @ SB @` !-@p`HH$nt`"./0-@N(XJg LN^NuRJ-@fR D`HH $n&n ` =f pL N^NuRgp`H#A7lN^NuH 9A7lL<ANm09#A7lN^NuH.NG!N^NuHH -|B&n$n .A %A-Hp$g Jg` fJl R-@p?rA %$Hen dfT .". m`Lg d@.A)d2 RѮSmdp&p.fA(d\  epL N^NuBJl -@ .`HH &n$n A%-HJg* nX-Pg -n`XJaf-n`Bp$`Jgt././.HkN, &m2Ad  j DD``Jg n"nCd X Ba JR-Hp.fp$` p\fp$gd> p$f S&fJfS`Jop?n aJf&e pL N^NuB `HH$n` Jg f$R`µ dp$f LN^Nup`HH(nd<$n&T-Kp$g6 Jg0 fp?rA % &H`pLN^NuJf2`Sm \fR g`p$fJf . `p.gX`xHH$np4B@Br2 LN^NuHH$np$pppLN^NuHH4. $n 0@p0LN^NuHH$.$n @ @ @ LN^NuH9A;fN rf N^Nu.Hnp////./. /./N -@Jn #CH`././.HnN x -@Jl#CH`-nbf Jvbfdb b< ;NJ$0 00#CH`"#CH`#CH` #CHp` .`HH B9A;fN rf L N^NuBG ,#CH$nB` .fRRJfJf..N$H g ./././. / N^`Jg ".g9A;g&|A=`9A;f`BCHXJgr./././. //.N-@Jn2 QG ,f#CH`j CHfR CHg CHgvJg&./././. //.N"`Jg #CHp`HA-HJ fH.NG!S-@ 6. %f& d.Hn/.N AtP .B6 `2-n`*. /</./</<A7pHnNG!././././.NN^NuHH$n.A7zNG -H"g.A7/NG X-HgB../<HnNG P gG`RJgI0 AUgJgB.HnN DXJfRI0 AUfJgXI`RJgI0 AUgpAu./ /<AvNG!P.NG |Av LN^Nu.NG `NqHH BB-|-n-n-|P9A;fN rf L N^Nu9A;f  op`p-@=va-yA;`tB`ZJgBJA7lPp.p/p/NG$DP#A7Jl -yG ,`p. .Hp A;/9A7NG"4PJm=nA-H-|-n-n p.Hn/9A7NG$P". Tf-n=|` ծ nJngp0.././9A7NG!zP$nJod-np06a-@o=n-|`ծ n`=nJngp0.././9A7NG!zP$nJn"-yG ,.A7NG ~#A7`Jg4<b0.n=@Jng nc <`p0.$.Hn/9A7NG!zP$o n`JA7l@p.p//NG$DP#A7Jo$p.Hnp //</9A7NG# A;g .A;fTJf.p. .Hp A;/9A7NG"4PJm-|p./. /./9A7NG# `0p. .Hp A;p//. /./9A7NG# f 9A;"9A;ВLyA;-@Jn-|Bp.HnN AXp"9A7& 9A7" " HnHnN FxPHnđ//Hn 9A7R/NG#l$l> G ,fHnHnN FxPHnHnNPHnHnNP`VJf: A;o"Jgp./<Av/9A7NG"4PB-|`p./././9A7NG#N -@oZ-|0.vaf9A;fbg.A7NG ~#A7 9A;R-@-|R .A;mSJnJA7m.A7NG ~#A7JfVJfD#QG ,`L 9A; fJg.A7NG ~#A7 .`#PG ,`#G ,p`H A7g.A7NG ~#A7N^NuH 6a Ѷa 6b Ѷb.N4N^NuH 6a a 6b b.NN^NuHJblSaB@b B@bmRaB@bN^NuHH$n.NG p./* I/NG!2PB%j* * g* LN^NuHA -H././<A\N PN^NuHA-H./. /.N PN^NuHH$nA-H|-J J-H.NG!-@|./. HnN PLN^NuNqHH<$.$n Jop o#G ,`NG"vg<-JBBHnHn/NG$8 rf A L<N^Nu n`*| g g*JG-A(S&./NG *X @*Hf & |` f L` M`HH$.o*p n$ S$p A g f . /NXLN^NuNVH./.N LN^JogPO//<N ِ NwHHJf pLN^Nup.NG$&. &p/N X-HBxJg2c R`" .(-CvS.p/N Xp.NG$ -@p.NG$ .NG$,.AN lJf.NG$NG#p.NG$$Jm.p/N XJn JlJg Ђ.NG$.NG$, Ђ`Hp./<AN XN^NuNqHH$n&n (|A7I4 I4fJfpLN^NuI4 I#I4I`HH$n&n $.(|A7Sm"I4 I4fJfpLN^NuJmI4 I#I4I` o"oJgg `RJf NuHH<$n&n (J*K gJf L L<N^NuJg*f RRfJfJf L `*K`R`ґ`HH . $nBBBJ fA-H -a `RI$0)AUf  +g -fRRv(z,.`RJgLp0f` n$H g. / N XA &HJf LN^Nu. / N X(H fBA>` BR#A> K`HH$n$.BJ g-a Jmp$nI(p0IAUf4`RI(0IAUf  +g -f RRI(Jf p0gt ` *xg *Xft`tp0IAUg<0IAUg 0`0IAUg W` 7-@m pLN^Nupf0p0f**I0 AUg *xg *XfTI(0IAUg 0`0IAUg W` 7D`bRI(p0IAUgL0IAUg 0`0IAUg W` 7-@l L&`J g-a Jg ` D`NqHH-yG ,Jo" .rl 9A9$r®f LN^NuJA9lp.pA9//9A9 NP .f 9A9(I./<A93/ NG!P.NG!HnNG!XHnN bXX./<A98/ NG!P.NG!JA9 g.A9 / NG!X.NG!9A9g"NG!./<A9?/ NG!P.NG!JA9 g.A9D/ NG!XTE&n I$gvp gnAddp%g `% `I$pmf .A*c./<A9G/ NG!P` .. A(h/ NG!X.NG!` B. /./././.Hn/ NG!HnNG!X$ o$<p./<ABp//Hn/9A9NG#Jl9A9gNG"X-@ gJf.p/N Xp.NG$ .NG$,p.NG$p./<A9 NG!\X-@p.NG$.A9P/ NG!Xp>.HnNG!XIA "R./ /.NG!P.NG ~p.NG!9A9f*.NG$$og`HJg#A9 # A9Jg .#A9(JA9l\3ABp./<A9/<ADNG!P9A9g0p.p/p/NG$DP#A9p.p//9A9NG PN^NuH.A9NG ~#A9N^NuH-yA9$Jg#A9$ .N^NuHH NG"X-@f0p././<A9c/<A9`/<A9XN Pp.NG!.p/N X$H.p/N X&HHnNG$X-@g f.p/N X.p/N X f .L N^Nu .`H|H.NG! JgHn/.NG PJmp0. f.A9lNG$-Hgt`.A9l/<ARNG!XHvb/<ARNG!PHn/<ARNG!PJm0.nfp0. fnJg .f^.NG$ |AR LN^Nup./.NG%X SJf(.NG$p./<A9rNG$X-Hgt`&.NG$-HgJg 6ag`.NG$-HgJg 6af.A9r/<ARNG!XHvb/<ARNG!PHn/<ARNG!PJm0.nfp0. f|Jg .fj`p./.NG%X SJfL.NG$`NqHp./. /.NPN^NuHH BJg.NG!Jf pL N^NuNJ9A~f"-|.A9/<ANG!X.A9/<ANG!X./<ANG!X.A9/<ANG!X.ANG! |AG E .rL| A9 .L| -@JfAbp./<ANG!\X#Arg\p./9ANG"RXJf.ANG ~#A`.p.Hn/9ANG!zPp0.#A.ANG ~. /.NXJfr#Ar-nB-|Jf JAg -|`JB-| g4Jm .ҰlHn/.N P-@Jg g`HnHnNPJf$ gJfx fl`-|-|JAgN gBHnHnHn/.HnHnN@-@JgH f-|Jm .ְl(R`Hn/./.HnNf-Hf .`` f.N -a p`@HHn/.NPN^NuH. Hn/.NPN^NuHp./.NXN^NuHBJg$.NG!JgJ gA~-yAv` Hvb/.NG!PJf-|HnHn/6bXNG" Jf nf0.vb`gL-vbX.NG":-@.b\ vb\ pbN./.N X-@.`".b\ vb\ pbN.bXNG ~ nAvf #aAv` -aa.N 5N^Nu-n-vaJg`HJAzfb.HnNG"XJf0HnNG!XJo HnNG!XR.N 3 #Az"f N^NuHn/9AzNG!P yAz`HN-agpN^Nup`HNG!-@A9g$#A9`p.HpAvNXJAvfN^NuH-yAv`xHvb/.NG!PJfV-|HnHn/6bXNG" Jf nf0.vb`g .NV`-a pN^Nu-vaJfp`H-Arb=a=obp.HvbN AX Aflp.p/p/NG$DP-@ f -a `.p././.NG"4P-@l.NG ~- a pN^Nu.NG ~p`HJAf`BA-a `-Arb=a=Abp.HvbN AXp.p//NG$DP-@ gBG ,p././.NG""P-@.NG ~ f4 DG ,g" G ,f AdNG"JgpN^NuBA- a p`HBA-|-n -|B-|./<Hn |A9/(/(p//</.N P-Hf-a`~ |A9./(/<A/< Hn/< xp//. vb PN-@. vb hN.NG ~JfJAgpN^Nu- ap`.A9|N -ap`H AgJ9A~f|p./<ANG!\X#A g>p./9ANG"RXJg&p.p//9ANG!2Pp ././9ANG!zP.ANG ~B`-| a f o -a ./<Hn |A9/(/(/6a /</.N P-Hf-a` |A9./(/./< /./< 0p//. vb PN-@. vb hN.NG ~Jgp`pA~JfT afpN^Nu a f m a f .A9|N A~-a`VA~ f( a f- ap`-a `.A9|N BA-ap``HJAgpN^Nu. HnNXJfp`. /.HnNP`H-|Bpf.N 3 -Hf .A9p/N X-a`-bbJ=bF=bbHp.HvbNN AX=bbV-bX  fp`p-bb.@/<HvbX |A9/(/(  fp`p//<HvbFN P-b\f.N 5-a N^Nup.p//6bXNG Pp.HnN AX=|p.Hn/6bXNG""PHnHn/6bXNG" Jf8=b`.HvbNG!X-Ava#Av n`^.N 5-a`DH-|.@/<Hn |A9/(/(p//<HvbFN P-Hg |A9./(p//< //< //. vb PN-@JfL.b\ vb\ pbN.bXNG ~-b\-bX-bbN^Nu. vb hN.NG ~`HBBN fpN^NuHnHnHnHn/. yAz-a/N Ũ-@Jg .N 5Jg .N 5.N`H .Jg g g gpN^Nup`NqHJ g>Jg8.NG!-@. NG!-@Jg @b Jg @cpN^Nu.N ,.A9|N Hn/.N P-@f bbf | Ɛ` | -H./././. |A9/(/(/./. /. nN -@ gr .`fHB-n-n -H-HB-nA./(Hn/< ,Hn/< ׺p//6b\ vb\ paNJgpN^Nu g.N -@Jf@ .T.N 3 -ag" .T.N 3 -a$f.aN 5-|Jf~-a ./6a/.N AtP vaA% vaA&B-a(./6a$/.N AtP va$A% va$A&BHn/< ,/6b\ vb\ pb N .`H.(/.$/. /.A/(/(/./. /.NF -@Jf2.(/.$/. /.A/(/(/./. /.N> N^NuHB-|-n-n BBBBA./(Hn/< ֐Hn/< `p//6b\ vb\ paNJgpN^Nu g.N -@Jf@ .T.N 3 -ag" .T.N 3 -a$f.aN 5-|Jf~-a ./6a/.N AtP vaA% vaA&B-a(./6a$/.N AtP va$A% va$A&BHn/< ֐/6b\ vb\ pb N .`HJ gDJg>Jg8.NG!-@. NG!-@Jg @b Jg @cpN^Nu.N ,.A9|N Hn/.N P-@f bbf | ` | ̪-H.$/. /./. |A9/(/(/./././. /. nN(-@ gj .`^HB-n-n -n-n-H-HB-nA./(Hn/< ,Hn/< lp//6b\ vb\ paNJgpN^Nu g.N -@Jf@ .T.N 3 -a$g" .T.N 3 -a,f.a$N 5-|Jf~-a(./6a$/.N AtP va$A% va$A&B-a0./6a,/.N AtP va,A% va,A&BHn/< ,/6b\ vb\ pb N .`H.0/.,/.(/.$A/(/(/./././. /.NF(-@Jf2.0/.,/.(/.$A/(/(/./. /.N N^NuHB-|-n-n -n-nBBBBA./(Hn/< ֐Hn/< `p//6b\ vb\ paNJgpN^Nu g.N -@Jf@ .T.N 3 -a$g" .T.N 3 -a,f.a$N 5-|Jf~-a(./6a$/.N AtP va$A% va$A&B-a0./6a,/.N AtP va,A% va,A&BHn/< ֐/6b\ vb\ pb N .`HBB`Jf.A9/9A9/6aN APJf-va-va BaBa .a$N 5Ba$Ba(.(/.$/. /.A/(/(/./././. /.N(-@.N 5B`V .N^NuHH $n&n f#ABL N^Nu$`HH$nJg .N 5Jg .N 5J g . N 5Jg .N 5p ./ N AX.N 5LN^NuHHp .N 3 $H gxp ./ N AX.NG!R.N 3 %HgH. NG!R.N 3 %H g..N 3 %Hg.N 3 %Hg J LN^Nu.N`HH $.J gHJgB.NG!-@. NG!-@Jg @bJg @b JgJf pL N^Nu˗B$yA g *f./*/.N APJf. /. NG!XJf./.NG!XJf|HnHnN FxP . ,bd *T-@.N 3 -a"fp`R./6a/*N AtP-a g&$A#Ap` mV./ NtX.N`.N ,.A9|N Hn/.N P-@f bbf | n`&J$RR` | Ԗ-H./. |A9/(/(/.//./. /. nN -@ gfJf 6aT-@.//. /.NH $H gzHnHnN FxP$A#A%n./*NG!X. /* NG!X%B ./*/.N AtP./*/6aN AtP%va .`HB-n-n -n-nBBA./(Hn/< Hn/< lp//6b\ vb\ paNJgpN^Nu g.N -@Jf .T.N 3 -a$f-|Jf>-a(./6a$/.N AtP va$A% va$A&BHn/< /6b\ vb\ pb N .`LHB-|-n-n -n-nBBA./(Hn/< ֐Hn/< `p//6b\ vb\ paNJgpN^Nu g.N -@Jf .T.N 3 -a$f-|Jf>-a(./6a$/.N AtP va$A% va$A&BHn/< ֐/6b\ vb\ pb N .`LNqH . bp ;NJ XDbNb:0&bB`N-|`D-|`:-|`0-|`&-|`-| `-|`-| .N^NuHp./<A:Hvb /. /.N vN^NuHp./<A:$Hvb /. /.N vN^NuH-n Hn/.N 0PJgHvb B/.N ؚPJgpN^Nup`NqH.Hvb /. /.N N^NuHp@./. /.N PN^NuHp@./. /.N PN^NuH. /.NXJg2Hvb /.NPJgHvb /.N\PJgpN^Nup`H. /.NfXJgHvb /.NnPJgpN^Nup`H. /.N XJgHvb /.NPJgpN^Nup`H. /.N XJg2Hvb /.NPJgHvb /.NPJgpN^Nup`Hp./. /.N PN^NuH. /.NXJg"p.Hvb /.N PJgpN^Nup`Hp./<A:HHvb /. /.N vN^NuH./. /.N PN^NuH. /.NXJgJHvb /.NPJg4Hvb /.N PJgHvb /.NPJgpN^Nup`Nqp&N@dNG fNuNqHH$nJm m&|A:` *"ЀЁ |A:dG Jm m(|A:` *"ЀЁ |A:zI  *l.//*/*/* / / /<A:/<ANG! |A LN^NuHH $np .N 3 -H"f.A:`B . V" -@ .$V" -@$pbЮ Ю$.N 3 &H f.A;p/N X`DA`A%$'HX.HnN FxXJvbf.p././. /.N h =@g =b-A:b-bA"n '|AC '|$'|('n T'n$\NG!".".-@B-|-n -np./. /+XHk8N HnHk8N XPJgNHk8 sb<NX'@PJl-|p.p//NG$DP$Jl># CQ&#G ,CQ. g.N 5Jg .N 5 L N^Nu./N  XHn/<f~/NG! '|`B&N -a n`HH$n."`/<"`/ A/(/(/./. /.N LN^NuH(H,$n&j-|L (f ADC `ADC$ B|BAtC I8B.P/ tbNXRsaXHn / tbNPJg(./ R pb NXJg./ nNXJfp`<. tbN$.Hkp///+X/NG#g'yG ,0p'@,L,N^NuJDfJHgA"|CQ6 -n-np.HnN AXp"( " " AlCt ` 7G ,f8`pe +`aXfp./Hk`HnN HnHnN P-@PJg|Hk,HnN PJ,fDHn/ R pb NPJf'|,'|0Jg>(Hn/ N xP`(JLo". R pb NJgSL`'|, +,`AC HnTHndN FxPHnl//HnN H/NG#l gLJg-|HnHnp//+\Hk`/NG#T&Jl G ,gJl` G ,fHnTHn\N FxPHndHn\N XPHn\HnlN XPJln$ .tѮ| .xѮ` R|B@ B@l tl( .xѮx .tѮt` RtB@x B@xl .|Dm6Df .Hl`"p`J'yG ,0p`Sl .NG ` jRp-@gr./.NG!Xrgn`pp*f Bp$`-|B` .Ѐ"ЁЂ0-@p$0)AUfJf-|-B rlg hfp$Jgp[fHn/ NP&H f pL N^Nu0)AUg-|l pcgFp[g@Sl .NG ` jRp-@0 AUf./.NG!Xrgjpcg psgp[fHn/ Hn/.//.N&`Hn/ /././/.N:-@g .ѮJg Jf`Jg .`p`HH . $nGBBBBBB . d bR ;NJ.***FFFFFFF2FFFFF.FF6Rv `v`vSl.NG `pL . N^Nu jRp$ +g -f$RS`.NG ` jRp$Sm0)AUfpff0)AUgX0)AUgp0`0)AUgp7`pW"-A lJgJf L.Ю-@R`xJg~p.f .RJg\pegpEf\JgT .RJfF Sl .NG ` jRp$0)AUf p+gp-f Sl`JgJgJgVBHnNG HXJg lfXa va0ua`XXa va0ea`BJg g .D-@ lg> hf4Xa va1a./NG!XrfBa .`Xa va!a`HH<$.&. (.$n&nJgXa va h`(H-Lpcf fxSl .NG ` kRp*pg.psf 0YAUfp[fJ2YfJg RSnpgJo./NG!XrfBaf pL@".!A; . A;f .B A; .1 A; .15 A;R m-|./<HnNG P g8p./<A=1HnNG!PJfG`R  g  gJf` o#A;.NG J9A<f>.HnN _XJf(p..HnNG!X&H gHk/<A<NG!P.A=gNG &H g./ /<A<NG!P(|A=(A<&|A<B` .fRRJf&|A<`p../ NG!X&HR(S mA=eA;pLN^NuHH $n$RyA< 4A< . DpAA9A;gp`pA9A;gp`pBjBjBjBj Gb$  (A-HX $ nXBA-H9A;gzJ grJ6a ghp../. N HX fR9A;fN rf L N^NuJ9A<g(.A</. /<A=tHnNG! A-H .Jg fZ .(r ҮmB./.N XT./.N XT.p/N XX./.N XTJg./ /.N AtP5|`Y(.Hn/.(/ /. N $mh•(./.N XT./.N XT5|JgJg~ (.Hn/.(/ /.N $lp`•(.p /N XT./.N XT.p/N XX.p/N XT5| $`RHH $n&n ./ N XJg&.HkHk/ N L N^Nup`HH $n&n p./ / N PL N^NuHH $n&n ./ NjXJgRHk / N PJg> + Jg gpL N^Nu./ kNX`Hk/ N PJfp`Hk/ N P`HH $n&n ./ N XJg8 Jg f*Hk/ N PL N^NuHk/ N PJfp`Hk/ N `HH $n&n ./ N XJgFHk/ N PJg4 f*./<A=Hk Hk/ N vL N^Nup`HH $n&n B'|Jf`./ N XJgNHk/ N PJg Gp.p/Hj(/ N ./ N xXHj / N xP. sbN%@.@ @ @ }@ VQ@ '!@ yq8*@  \R@ @3!@ ߶߫2߅n@ @ @ ޠޒ@ d_@ k;7@ K$H@ <ݺݵݜݐ QF@ 6 @ ܣܝ@ vp@ -(@ @ ۹ۭۂz@ 7M? <ڽhڠڗ||w@ G?(@ @ 5ٶٰ@ ={sE=@ `@ @ iة؟v@ G; @ @ ׯק@ wi@  @ zg] @ դ՞@ `gX@ %!@ >ԿԹ@ Ԋԃ@</r@ !VO@ I?5@ JҴҨ@ qd@ 8ѳѨ@ щ|@ xG?@ @ G@ НЙ@ oiPF& @ 4@ `Ϭϣ$@ RΧΠ@ ?΄~ͼA1@ vk_QB:3-$ r`VI;*@ M@ N@ P@ Q@ R@ U@ V@ W@ X@ Y@ Z@ [@ \@ ]@ ^@ _@ `@ a@ b@ c@ d@ e@ f@ z@ {@ |@ S@ T@ }@ ~@ @ @ @ O@ @ @    WTWTJ<)W `o|XXj\QC6  #WTWT2UWTU@UjzX8,$@SfТМД@ CCF@ !VΈk΢U@ ?@ |7@ 2*@ 1@ 3@ Fμ@ >@ @ @ @ @ v@ Y@ C@ %@  T|@ nЪvk@ V@ @D@ ;@ .@ E@ @ @ @ '@ @ @ &@ n@ 6cWOFCCB:@ /@ %&Ҕ@ @ l@ m@ @ @ F@ =e@ H@ <CC:+@ 7@ {@ D6@ ~z@ f@ W@ kD@ ;)@ i@ @ @ @ ߫@ ߙ@ ߆@ o@ U@ M׬<@ )@  H, ֞@ @ =@ ޺@ ޮ@ ޢ@ ޕ@ "މyh[@ 8Q@ ?@ (@ 4!@ @ @ @ ݱ@ pݝ@ tݔ@ ݂@ y{ l@ Z@ ?O<@ P<KHI@W2N ? 6!*L84=QX)*,EFG/30791\%;-.A BOJ84=5X(*,EFG/307 91\%:-. $&%+&CCR%\YX[Z\]YX[Z\]CUN2-aZ8/ |wKG!o`.xpLBqh;. \V%~[N2*sn93mf3-fY2$upE>"rjA4 k`2'REqf?8QI?4( ZV;+&   lh TO ?:)#|vb]HB.(|t]X HH$$$4@7$$$4@8@$$$4@8$$$4@8$$$4@9%%$4@9`%%$4@9%$%!$4@9%0%-@:8%5%- @:%;%- @:%A%-@;%G%-@;X%M%- @;%S%-!%@;%^%Y@<0%c%Y @(%%@>p%%@>%%@?%%"@?H%% (@?%%&.@?%% @@ %%@@h%% @@&%@@&%@A@&'%#@A&8%!(@A&M&I$4@B&Y&U$4@B`&n&f$4@B&~&v$4@B&&$4@C8&&@C&&@C&&@D&&@DX&&@D&&@D&&$4@E0&&$4@Ex''$4'@E,:,1,,,:+,+,:+++,:+++,:+x+\+,:+D+++,:++++,:***,:***,:*+\*,:***y,:*h**y,:*S**y,:*J**3*,*%****%*))*%*)))*)))*)))*)))*)s,:)o*)],:)L);)&,:))(,:(((,:(((,:()(,:(r,:(X,:(/,:(,:',:'CHCBC<@C6 C0C*C$CC                     T  TUV  +23@S@@S@@K@N@P2 eBSQOMKIGECCA?=;97531/-+)'%#!    |xuqnkheb`^[YUY@U@Wl;200~ytnhc\VQLF?81*# ytmgaZSMFA;5.' +$A[>AnBA\>AnJAnRA]>A^>qd7(""4"0","("$" """4"0"","("$" """ """b"""" """""""I"""""""""""""""ؾؼظصزدحثبئؤء؞؛ؖؑ،؊؇؄؁~{xurolifc`c]ZWTQNKHEB&?2<3986?3@0A-B*I'J$P!QRSTfgpq  ׼׹׶׳װ׭תקפסמכטהא׌׈ׄ׀|xurnjgd` \ Y V R NKHD@=:62/,R)S&V#W X\]^!` d efhm0nopstuvz{}־ְַ֪֧֥֛֭֞֘֕֎֋ֈօւ|xtpligda^[XUROMJGDA>;85 52/$t%++l4'@%AحBMD"EG`tحuؤz~" ֥lվջոնմղհծլժHըզդբՠ՞՜՚՘ՕՓՑثՏՍՋՉՇՄՁ~{unhc_\YVSPMJGD=8"52/,)&#       ֥ !"#$%&'()*+,ح-./0ն1մ23ղ4հ5ծ67լ8ը9Շ:զ;դ<բ=ՠ>՜?՚@՘AՓBՑCثDՏEF՞GHIJKժLحMNOQRSTUVWXYԿZԼ[\Թ^Զ_Գb԰cԭjԪkԧrԤsԡtԞuԛԘԕԒԏ؁cԌԉԆԃԀ}zwtqnkheb_\YVSPMJGDA>; 852!/",#)$&%#& '()*+,- ./0123456789:@ABCDEFGHIJKLӽMӺNӷOӴPӱQӮRӫ`ӨaӥbӢcӟdӜeәfӖgӓhӐiӍpӊ~ӇӄӁ~{xӨӥӢӟӜәӖӓӐӍurolifc ` ] Z WTPMJGDA>:741.+($  !"#$% & '()*+,./012346789:;<=>?@ҿAҼBҹCҶDҳFҰHҬJҨKҤLҠMҝPҚQҗRҔSґTҎVҋX҇Z҃[\{]x`uarbocldiffgbh_i\jYkVlSnPoLpIqFrCs@t=v:w6x3y0z-{*|'~$   ѽѺѷѴѰѬѨѤѡўћјѕђяычу|yvspmjgZfda^[XUROKHEB?<952/,(%"      олиевЮ Ы!Ш"Х#Т$П&М'И(Е)В*Џ+В,Ќ.Љ/Ѕ0Ђ12|3y4v6s7o8k9g:c;_<[=X>T?_@PALBHCPDDEAF=H:I7J4K:L1N.O*P'Q$R!STVWXY ZbdeQfghijklmnopqrstuvwxyϾzϺ{ϵ|ϮϪϦϣϠϜϘϕϒώ ϊ χ # σ |yvsokgc_[WSOKGC@= :!7"4#1$-%)&&'#( )*+,- . /0123456789:;<=>?@ABCνDκEFζGβHίIάJΨKΤLΠMΜNΘOΔPΐQΌRΈS΄T΁U~V{WxXuYZq[m\h]c^`_]`ZabVcRdNeJfFgBh=i8j5k־l1m-n*o'p#qrstu v wxyz{|}~;ͻ͸͵Ͳ͔͍ͮͪͧͤ͛͐͊͆͂͘͡͞~zvrnje`\XTPLHD@;62.+(%" ̷̢̼̲̮̪̦̞̖̒̍̈̄̀̚}zvrnjfb^ZUPMJFB?<96lf2.+' $ !   ui1o9AfI QrY        2   ! " %˾ &˺ 'ئ (˸ )˵ , - / 0˯ 2ح 35 4˫ 5% 6/ 7˧ 8В 9˥ :ˣ ;ˠ <˝ >˚ D˘ H˕ I˒ pˏ tˌ uˉ vˆ w˃ xˀ y} zz {w |t }q ~n k h e b _ \ Y V S P M J G D B @ = : 7 4 0!,!(!%!!!! !!!դ! ! !!!! !!!"!&!+!.!5!6!7!8!S!T!Uʾ!Vʹ!Wʴ!Xʯ!Yʪ!Zʥ![ʠ!\ʛ!]ʖ!^ʑ!_ʍ!`!a)!bʉ!cʆ!d !eʃ!f!gz!hw!i!jt!kp!l!m!n!o!pը!q!rl!si!t!uY!ve!w`!x]!yՍ!z!{Y!|դ!}՞!~հ!բ!Q!K!D!A!>!;!8!4!1!-!)!%!!!!!!!! ! !"""П""""" " " " " """""""ɿ"ɽ"ɺ"ɷ"ɰ"ɨ"ɠ"ɝ"ɗ"ɔ" ɑ"%Ɏ"&Ɉ"'Ʉ"(Ɂ")~"*{"+u",r".o"4l"5i"6f"7"<c">`"C]"EZ"HW"IQ"LN"SK"TH"UE"`B"a?"b9"d6"e3"f."g)"h"i"j"k؛"n"o "v"w""""""""""""""""""Ƚ"ȹ"ȶ"ȭ"Ȧ"ȝ"ȓ"Ȉ"~"i"K"*""""""""""""#ǽ##Ǻ# Ƿ# Ǵ# DZ#Ǯ#ǫ#Ǩ#ǥ# Ǣ#!ǟ#"ǜ##Ǚ#$Ǖ#'Ǒ#)ǎ#*Nj$#Lj$@Dž$Aǂ$B$C|$Fy$Gv$Hs$Ip$`l$ah$bd$c`$d\$eX$fT$gP$hL$iG$jB$k=$l8$m3$n.$o)$p$$q$r$s$t$u $v $w$x$y$z${$|$}$~$$$$$$$$ƿ$ƺ$Ʒ$ƴ$Ʊ$Ʈ$ƫ$ƨ$ƥ$Ƣ$Ɵ$ƛ$Ɨ$Ɠ$Ə$Ƌ$Ƈ$ƃ$${$w$s$o$k$$g$c$_$[$W$S$O$K$G$C$?$$;$7$3$/$+$'$#$$$$$$$ $$$$$$$$$$$$$$$$$$$ſ$Ż$ŷ$ų$ů$ū$ŧ$ţ$ş$ś$ŗ$œ$ŏ$ŋ$Ň$Ń$${$w$s$o$k$g$c$_$[$W$S$O$K$G$C%ؼ%%%%ؼ%%%%ؼ% % % %q˘%rA%>%;%8%5%2%/%,%)%&%#% %%%%%%% %%%%g%%%%%%%%%%%%%%%%%%%%%%&&&&Ŀ&Ļ&ķ&!Į&'ī&9ħ&:ģ&;ğ&<Ĝ&@=&B&`ę&aĖ&bē&cĐ&dČ&eĈ&fĄ&gĀ&i}&jz&kw&ls&mմ&np&on' k0h0e0b0^0[0X0U0 R0 O0 L0 I0F0C0@0=0:0704010.0+0(0%0"0 0A0B0C0D0E0F 0G0H0I0J0KѺ0L0Mѽ0N0O0P0Q0R0SѴ0T0U0VU0W0XX0Y0Z[0[0\^0]0^O0_@0`0aC0b0c0dF0e"0fI0g%0h:0i0j0k0l0m0n0ol0pl0q0ro0so0t!0ur0vr0w$0xu0yu0z'0{f0|f0}0~.0104070(000000,0000000p0s0y0j00\00000000000000ý0ѕ0и0ј0л0ћ0о0ў00я0в0ú0?0÷0B0ô0E0ñ0H0î090Т00Х0 0ë0Ш0 0Ы00М0000000D0è0y0G0å0|0J0â00M0ß0Ђ0>0Ü0s0Ù0Ö0Ó0Ð0Í00Ê00Ç0Ä0Á0~0{0x00u0r0o0l0i0f0c0`0]0ђ0Z0W0T0Q0N0K0H0E1B1?1<191 61 31 01 -1 *1'1$1!1111111111 1 11111 1!1"1#1$1%1&1'1(1)1*1+1,22 2!2"2#2$2%¾2&»2'¸2(µ2)±2­3ª3§¤4¡™–“}‹‡ƒ{wsokgc_[WSOKGC?;73/+'# {wsokgc_[WSOKGC?;73/+'#      }yvspmifc`]ZXؾؼحؤ،aɽ^l[˘XH!""4"","("$" """4","F"$" "B">   P]"4"  ""$ TQN"4"","("$" ""!"دزءؖؑ،a^ɽ[X՚!"#"^$"Z%"X&"U'ح(B)@*ɽ+"S,ؤ-ؼ.ئ/˘0"Q1"O2"M3"K4"I5"G6"E7"C8"A9"?:"=;<˥=>ˣ?؊@"9ABCDEFGHIJKLMNOPQRSTUV W"7XYZ֥["3\"/]"+^"'_"%`"!aնbմc՞dհeծfՏgղhiըjՇkզlդmբnՠo՜p՚qՋr՘sՓtՑuثvwՉxՍyժzլ{"|"}"~"" " ""!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!!}!y!u!q!m!i!e!a!]!Y!U!Q!M!I!E!A!=!9!5!1!-!)!%!!!!!!! ! !!                                 } y u q m  i  e  a  ]  Y U Q M I E A = 9 5 1 - ) % !      ! " # $%&'()*+,-./0123456789:;<=>?@ABCD}EyFuGqHmIiJeKaL]MYNUOQPMQIRESAT=U9V5W1X-Y)Z%[!\]^_` a bcdefghijklmnopqrstuvwxyz{|}~}yuqmiea]YUQMF?81*#  {wsokgc_[WSOKGC?;73/+'# {wsokgc_[WSOKGC?;73/+'#      !"#$%&'()*+,-./0{1w2s3o4k5g6c7_8[9W:S;O<K=G>C??@;A7B3C/D+E'F#GHIJKL MNOQRSTUVWXYZ[\^_bcjkrstu{wsokgc_[WSOKGC?;73/+ '#!"#$% &'()*+,-./0123456789:@ABCDEFGHIJKLMN{OwPsQoRkpg~c_[WSOKGC?;73,%!      {w s!o"k#g$`%Y&U'Q(M)I*B+;,4--.&/0123 456789:;<=>?@ABCDEFGHIJKLM|NuOnPgQ`RYSRTNUJVFWBX>Y:Z3[,\$]^_`a bcdefghijklmnopqrstuvwx{ytzm{f|b}^~WPLHD@<840)" ~wpib[TMF>6/($  zsld\UNG@92+$ |xtp l h d ` \ X T P L H D @ < 8 4 0 , ( $    ! % 0 2 3 4 5 6 7 8 9 : ; < > D p t u v w x y z { | } ~          } y u q m i e a ] Y!U!Q! M!I!E!A! =!"9!&5!+1!S-!T)!U%!V!!W!X!Y!Z![ !\ !]!^!`!a!b!c!d!e!f!g!h!i!j!k!l!m!n!o!p!q!r!s!t!u!v!w!x!y!z!{!|z!}r!~j!a!V!M!C!?!;!7!3!/!+!$!!!! !!"""""""" """""""""""" "%"'"(")"*"+","."4"5"6"7"<">{"Cw"Es"Ho"Lk"Sg"`c"a_"d["eW"jS"kO"nK"oG"C"?";"7"3"/"+"'"#"### # #  #### #!#)#*$#$@$A$B$C$F$G$H$I$`$a$b$c$d$e$f$g$h$i$j|$kt$ll$md$n\$oT$pL$qD$r<$s4$t-$u&$v$w$x$y $z${$|$}$~$$$$$$$$$$$$$$$$$}$y$r$k$d$]$V$O$H$A$:$3$,$%$$$$ $$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ }$ v$ o$ h$ a$ Z$ S$ L$ E$ >$ 7$ 0$ )$ "$ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ $ z$ s$ l$ e$ ^$ W$ P$ I$ B$ ;$ 4$ -$ &$ $ $ $ $ % % % % % % % % % %  %  %  %  %  % % % % % % % % % % % % % % % % % % }%  y%! r%" k%# g%$ c%% _%& X%' Q%( M%) F%* ?%+ ;%, 7%- 0%. )%/ %%0 !%1 %2 %3 %4 %5 %6 %7 %8 %9 %: %; %< %= %> %? %@ %A %B %C %D %E %F %G %H %I %J %K {%q w%r s% o% k% g% c% _% [% W% S% O% K% G% C% ?% ;% 7% 3% /% +% '% #% % % % % % % % % % % % % % % % % % % % % & & & & & & &: &; &< &@ &B &` &a &b &c &d &e &f x&g q&i m&j i&k e&l ^&m Z&n V&o R' N' J'  F0 B0 >0 :0 60 20 .0 *0 &0  "0  0  0  0 0 0 0 0 0000000 0A0B0C0D0E0F0G0H0I0J0K0L0M0N0O0P0Q0R0S0T0U0V0W0X0Y~0Zz0[v0\r0]n0^j0_f0`b0a^0bZ0cV0dR0eN0fJ0gF0hB0i>0j:0k60l20m.0n*0o&0p"0q0r0s0t0u0v 0w0x0y0z0{0|0}0~000000000000000000000000000~0z0v0r0n0j0f0b0^0Z0V0R0N0J0F0B0>0:06020.0*0&0"000000 00000000000000000000000000000000000~0z0v0r0n0j0f0b0^0Z0V0R0N0J0F0B0>0:06020.0*0&0"000000 11111 1 1 1 1 1111111111111111111 1!1"1#1$1%1&1'{1(w1)s1*o1+k1,g2_2 [2!W2"S2#O2$K2%G2&C2'?2(;2)42-)%! }xqjc\UNG@92+$|ung`YRKD=6/(! yrkd]VOHA:3,%     ~zvrnjfb^ZVRNJFB>:62.*&"  -!"#-$-%"X&-'ح(B)@*ɽ+"S,ؤ-ؼ.ئ/˘0"Q1"O2"M3"K4"I5"G6"E7"C8"A9"?:"=;<˥=>ˣ?؊@-ABCDEFGHIJKLMNOPQRSTUV W"7XYZ֥[-\-]-^-_"%`-aնbմc՞dհeծfՏgղhiըjՇkզlդmբnՠo՜p՚qՋr՘sՓtՑuثvwՉxՍyժzլ{-|˝}-~-----Џ--~-{-xЉ-u-r-o-lص-i-f5-c-`-]-Z-W؞؛-T-Q-N-K-H-E-B-?؄؁~-< -9-6-3-0--{-*-'-$-!--r----^li- - --`c]-,,,ջ,,W,,Ձ,,,QN,,,XH,,,,,,,,,, , , , , ,,,EB,,,,,,,,,,,,,,| ,y!,v",s#,p$,m%,j&?',g(,d),a*,^+,[,,X-,U.,R/,O0֪1,L2<394,I5,F6,C7,@869,=:,:;,7<,4=,1>,.?3@0A-B*C,+D,(E,%F,"G,H,I'J$K,L,M N,O,P!QRSTT, U, V,W,X,Y+Z+[+\+]+^+_+`+a+b+c+d+e+fgh+i+j+kl+m+n+o+pqr+s+t+u+v+w+x+y+z+{+|֧}+~+  +++++++++׼׹׶׳װ׭תקפ+++}+z+w+tסמכט+q+n+kהא׌׈ׄ׀|xurnjgd` \ Y V R NKHD@=:62/,+hi+eda^XURO+bJt+_u+\z~"+Y+V+S+P+M+J+G+D+A+>+;+8+5+2+/+,+)+&+#+ +++++++ +++վ*ո*****************Օ********Մ*~{*YVSPMJGD52/,)&#     ****************~ *{!*x"*u#*r$*o%*l&*i'*f(*c)*`**]+*Z,*W-*T.*Q/*N0*K1*H2*E3*B4*?5*<6*97*68*39*0:*-;**<*'=*$>*!?*@*A*B*C*D*E* F* G*H*I*J)K)L)MNOQRSTUVWXYԿZԼ[\Թ^Զ_Գb԰cԭjԪkԧrԤsԡtԞuԛԘԕԒԏ)ԆԃԀ}zwtqnkheb_\YVSPMJGDA>; 852!/",#)$&%#& '()*+,- ./0123456789:@ABCDEFGHIJKLӽMӺNӷOӴPӱQӮRӫ`ӨaӥbӢcӟdӜeәfӖgӓhӐiӍpӊ~ӇӄӁ~{xϪϦϣϠϜϘϕϒώ ϊ χ # σ |yvsokgc_[WSOKGC@= :!7"4#1$-%)&&'#( )*+,- . /0123456789:;<=>?@ABCνDκEFζGβHίIάJΨKΤLΠMΜNΘOΔPΐQΌRΈS΄T΁U~V{WxXuYZq[m\h]c^`_]`ZabVcRdNeJfFgBh=i8j5k־l1m-n*o'p#qrstu v wxyz{|}~;ͻ͸͵Ͳ͔͍ͮͪͧͤ͛͐͊͆͂͘͡͞~zvrnje`\XTPLHD@;62.+(%" ̷̢̼̲̮̪̦̞̖̒̍̈̄̀̚}zvrnjfb^ZUPMJFB?<96 ) ) ) ) ) ) ) ) ) ) ) ) ) )  ) ) ) ) ) ) ) )  ! ") %˾ & 0) 2) 3) 4) 5) 6) 7) 8В 9) :) ;ˠ <) >˚ D) p) t) u) v) w)~ x){ y)x z)u {)r |)o })l ~)i )f )c )` )] )Z )W )T )Q )N )K )H )E )B )? )< )9 = : 7 4!%!$! !)6! !! )3!")0!&)-!+)*!S)'!T)$!U)!!V)!W)!X)!Y)!Z)![)!\) !]) !^)!`)!a)!b(!c(!d(!e(!f(!g(!h(!i(!j(!k(!l(!m(!n(!o(!p(!q(!r(!s(!t(!u(!v(!w(!x(!y(!z(!{(!|(!}(!~(!(!Q!K!D!A!(!;!8!(!1!-!)!%!!!!!! !(""("П"(""("" "("(~"({"(x""(u"ɺ"ɷ"(r"ɝ"(o"ɔ" ɑ"%Ɏ"'(l"(Ɂ")~"*{"+(i",r".o"4l"5i"6f"7"<c">`"C]"EZ"H(f"LN"SK"`B"a?"d6"e3"j(c"k(`"n"o """""(]"(Z"ȶ"(W"#ǽ#Ǻ# Ƿ# Ǵ# DZ#Ǯ#ǫ#Ǩ#ǥ# Ǣ#!ǟ#)ǎ#*Nj$#Lj$@Dž$Aǂ$B$C|$Fy$Gv$Hs$Ip$`l$ah$bd$c`$d\$eX$fT$gP$hL$iG$jB$k=$l8$m3$n.$o)$p$$q$r$s$t$u $v $w$x$y$z${$|$}$~$$$$$$$$ƿ$ƺ$Ʒ$ƴ$Ʊ$Ʈ$ƫ$ƨ$ƥ$Ƣ$Ɵ$ƛ$Ɨ$Ɠ$Ə$Ƌ$Ƈ$ƃ$${$w$s$o$k$$g$c$_$[$W$S$O$K$G$C$?$$;$7$3$/$+$'$#$$$$$$$ $$$$$$$$$$$$$$$$$$$ſ$Ż$ŷ$ų$ů$ū$ŧ$ţ$ş$ś$ŗ$œ$ŏ$ŋ$Ň$Ń$${$w$s$o$k$g$c$_$[$W$S$O$K$G$C%(T%(P% %(L%(I%(F%(C%(@%(=% (:% (7% (4% (1% (-%()%(%%("%(%(%(%(%(%( %(%(%(%'%'%'%'%'%'% '%!'%"'%#'%$'%%'%&'%''%('%)'%*'%+'%,[%-'%.'%/'%0'%1'%2'%3'%4'%5'%6'%7'%8'%9'%:'%;'%<'|%='x%>'t%?'p%@'l%A'h%B'd%C'_%D'Z%E'U%F'P%G'L%H'H%I'D%J'@%K'<%P'9%Q'6%R'3%S'0%T'-%U'*%V''%W'$%X'!%Y'%Z'%['%\'%]'%^'%_' %`' %a'%b'%c'%d&%e&%fa%g&%h&%i&%j&%k&%l&%q&%r&%>%;%8%5%2%/%,%)%&%#% %%%%%%% %%%%&%%%&%&%%%&%%%%%%%%%%%%%&&&&Ŀ&&&&&:&&;&&<Ĝ&@&&B&&`ę&aĖ&bē&cĐ&dČ&eĈ&fĄ&gĀ&i}&jz&kw&ls&m&&np&o&'&'&' k0&0h0e0b0^0[0X0U0 R0 O0 L0 I0F0C0@0=0:0704010.0+0"0 0A0B0C0D0E0F 0G0H0I0J0KѺ0L0Mѽ0N0O0P0Q0R0SѴ0T0U0VU0W0XX0Y0Z[0[0\^0]0^O0_@0`0aC0b0c0dF0e"0fI0g%0h:0i0j0k0l0m0n0ol0pl0q0ro0so0t!0ur0vr0w$0xu0yu0z'0{f0|f0}0~.0104070(000000,0000000p0s0y0j00\00000000000000ý0ѕ0и0ј0л0ћ0о0ў00я0в0ú0?0÷0B0ô0E0ñ0H0î090Т00Х0 0ë0Ш0 0Ы00М0000000D0è0y0G0å0|0J0â00M0ß0Ђ0>0Ü0s0Ù0Ö0Ó0Ð0Í00Ê00Ç0Ä0Á0~0{0x00u0r0o0l0i0f0c0`0]0ђ0Z0W0T0Q0N0K0H0E1B1?1<191 61 31 01 -1 *1'1$1!1111111111 1 11111 1!1"1#1$1%1&1'1(1)1*1+1,22 2!2"2#2$2%¾2&»2'¸2(µ2)±2­3ª3§¤4¡™–“}‹‡ƒ{wsokgc_[WSOKGC?;73/+'# {wsokgc_[WSOKGC?;73/+'# &&     &&&&&&vspm&fc`]Z&&&&&&&&&&|&y&v&s&p&m&j&g&d&a&^&[&X&U&R&O&L&I&F&C&@&=&: ///D/ͻ9/  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^%%$ $ $ $ $$$ %%% %%<%%%$%4%,%"d"e"`&:&;&e&f&c&` "%%%&B&@&j&k&<%%! <%!!!!!"!%% !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~# #%%%%%$%a%b%V%U%c%Q%W%]%\%[%%%4%,%%%<%^%_%Z%T%i%f%`%P%l%g%h%d%e%Y%X%R%S%k%j%% %%%%%"")"a"e"d# #!"H"" %  !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~}<?? 0,($  !b !^ !Z !V !R !N !J !F !B !> !: !6  | y v s p m j g d a ^ [ X U R O L I F C @ = : 7 4 1 . + ( % "          q j d ] W P K D = 9 2 , %    } v o h b ] X Q M I B ; 5 . ' "     ~ y t m f a \ U O J D @ ; 7 2 - ( "      { w  P L G > 5 . '  L V a ] z q l f {  { P P  P P L  .   ]  P  .  ]  7 3 . ) k d \ U L E = z ] P  ] P ) ]  P . z ]  P L  . ]   k P L  . ) ] {  d " ) 3 P  7 { ] { = L A T V ] P  { > r j . ' c [ {  { .  ]  P   k { 3 ] { P . )  P P        P < 7 / .  '  k P P  F ] { A *PP a~ a aL `@ ` `ABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/=0123456789ABCDEF( P    `      B  L  " "{ "6 ! ! ! ![ !/ !' l (      Z     : << /d 2. J IZ Ch IZ Co IZ SZ TR Y Y Y Y Y Y Yy Yt Yi Y] YP YI Y9 Y+ Y$ Y Y X X X X X X Y c\ b cN ZB b bPPABCDEFGHIJKLMNOPQRSTUVWXYZabcdefghijklmnopqrstuvwxyz0123456789+/G \G \G \G \G \G \G \G \AACHunknownPackaged for USG UNIX 6.0, 3/6/83G \G \G \G \G \TERMG \TERMG \G \G \G \G \APASorry, I don't know how to deal with your '%s' terminal. Sorry, I need to know a more specific terminal type than '%s'. unknownG \G \G \G \G \2Kn,X `%KG \TERMunknownTERMINFO/usr/lib/terminfo/a//usr/lib/terminfo/ . /usr/lib/terminfo/ . No such terminal: corrupted term entry term entry too long LINESCOLUMNSG \G \G \G \AAAAAAAAAAAAAAAAAAAAAAA A AAAAAAA"A%A(A*A,A.A0A2A4A6A8A:A<A>A@ABADAFAHAJALANAPARATAVAXAZA\A^A`AbAdAfAhAjAlAnApArAtAvAxAzA|A~AAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAAA^@^A^B^C^D^E^F^G^H^I^J^K^L^M^N^O^P^Q^R^S^T^U^V^W^X^Y^Z^[^\^]^~^_ !"#$%&'()*+,-./0123456789:;<=>?@ABCDEFGHIJKLMNOPQRSTUVWXYZ[\]^_`abcdefghijklmnopqrstuvwxyz{|}~^?G \G \G \G \G \G \G \5MS7) G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \ downupleftrighthomebackspacef0f1f2f3f4f5f6f7f8f9dlildciceiccleareoseolsfsrnpageppagestabctabcatablla1a3b2c1c3G \G \G \G \G \A$@(#) Copyright (c) 1984-85 AT&T-IS, All Rights Reserved. {Apple version 1.2 87/11/12 15:55:53}G \A@(#) Copyright (c) 1980-87 The Regents of the University of California, All Rights Reserved. {Apple version 1.2 87/11/12 15:59:16}null argbad char after %3bad char after %2bad parm numbermissing closing quotemissing closing bracebad % sequenceno matching ENDIFG \G \G \G \G \G \G \G \G \G \G \G \G \G \G \G \Hash table full in dispcalcG \Bad call to _showstring, first %x, last %x, diff %dpcx G \G \G \G \G \G \A /pA /pCAAAAAA ApAAAAAAAAA A!A"A#A$A%A&CPOSIXLC_ALLLC_COLLATELC_CTYPELC_MONETARYLC_NUMERICLC_TIMECCCCC.LANGC(lptr = __knownLocale(category, head)) != NULLlocale.c. 0lAx = 0Unknown error: =|G \G \, line NNNNN Assertion failed: , file G \G \A<@(#)compatmode.c 1.2 ((((( H G \CM*CM*A&\CM2G \A*A*A*A*4A*DA*\A*fA*A*A*A*A*A*A*A*A+A+A+*A+6A+HA+WA+gA+vA+A+A+A+A+A+A+A,A,A,(A,4A,KA,\A,wA,A,A,A,A,A,A-A--A-<A-OA-XA-aA-jA-sA-|A-A-A-A-A-A-A-A. A.*A.;A.ZA.qA.A.A.A.A/A/)A/HA/XA/oA/A/A/A/A0A0A0<A0^A0sA0A0A0A0A0A0A1A1A1)A1BA1KA1TA1]A1fA1|A1A1A1A1A1A2gError 0Not ownerNo such file or directoryNo such processInterrupted system callI/O errorNo such device or addressArg list too longExec format errorBad file numberNo child processesNo more processesNot enough spacePermission deniedBad addressBlock device requiredDevice busyFile existsCross-device linkNo such deviceNot a directoryIs a directoryInvalid argumentFile table overflowToo many open filesNot a typewriterText file busyFile too largeNo space left on deviceIllegal seekRead-only file systemToo many linksBroken pipeArgument out of domainResult too largeNo message of desired typeIdentifier removedChannel number out of rangeLevel 2 not synchronizedLevel 3 haltedLevel 3 resetLink number out of rangeProtocol driver not attachedNo CSI structure availableLevel 2 haltedDeadlock conditionError 46Error 47Error 48Error 49Error 50Error 51Error 52Error 53Error 54Operation would blockOperation now in progressOperation already in progressSocket operation on non-socketDestination address requiredMessage too longProtocol wrong type for socketProtocol not availableProtocol not supportedSocket type not supportedOperation not supported on socketProtocol family not supportedAddress family not supported by protocol familyAddress already in useCan't assign requested addressNetwork is downNetwork is unreachableNetwork dropped connection on resetSoftware caused connection abortConnection reset by peerNo buffer space availableSocket is already connectedSocket is not connectedCan't send after socket shutdownToo many references: can't spliceConnection timed outConnection refusedToo many levels of symbolic linksFile name too longHost is downHost is unreachableDirectory not emptyDevice not a streamNo data (for delay IO)Timer expiredOut of streams resourcesError 91Error 92Error 93Error 94Stale NFS file handleToo many levels of remote in pathToo many processesToo many usersDisc quota exceededLocking deadlock errorNo record locks availableFunction not implementedG \G \G \pwdrTZG \A2D/etc/grouprr+group.bynamegroup.bynamegroup.byname++%dgroup.bygidA2/etc/hosts%d.%d.%d.%d.in-addr.arpahosts.byaddrhosts.bynamerhosts.byaddrr# G \A3/etc/passwdgetpwnam: passwd entry exceeds %d characters: "%s"getpwnam: %sgetpwnam: %sgetpwuid: passwd entry exceeds %d characters: "%s"getpwuid: %sgetpwuid: %srrgetpwent: %sgetpwent: %sgetpwent: passwd entry exceeds %d characters: "%s"getpwent: %s+*getpwent: %s*++passwd.bynamepasswd.bynamepasswd.byname%dpasswd.byuidinvalid name fieldpremature end of line after namepremature end of line after passwdnull uidinvalid uidpremature end of line after uidnull gidinvalid gidpremature end of line after gidpremature end of line after gecospremature end of line after home directory: ""G \netgroup.byusernetgroup.byhostinnetgr: recursive overflow netgroupinnetgr: netgroup %s called recursively innetgr: syntax error in /etc/netgroup innetgr: syntax error in /etc/netgroup innetgr: syntax error in /etc/netgroup # *G \GMTA6A6mn localtime/etc/zoneinfo/posixrulesTZG \%d.%d.%d.%dG \: Unknown error G \/bin/shsh-cG \G \%.*s.%.*sHOSTALIASESrG \G \G \G \  !"#$%&'()*+,-./0123456789:;<=>?@abcdefghijklmnopqrstuvwxyz[\]^_`abcdefghijklmnopqrstuvwxyz{|}~G \G \G \/dev/log/dev/consoleA9,syslog<%d>%.15s [%d]: error %d G \/bin/shsh-cG \/dev//dev/sxt/Z/etc/yp/binding/.0123456789load_dom_binding: malloc failure.G \A9YP_G \G \G \ l ׺ (  , (G \ ؚ G \SunMonTueWedThuFriSatJanFebMarAprMayJunJulAugSepOctNovDec??????%.3s %.3s%3d %02.2d:%02.2d:%02.2d %d G \ clntudp_create: out of memoryclntudp_create: out of memoryG \G \dupfd == newddup2.cG \G \A;PnetgroupCycle detected in /etc/netgroup: %s. # syntax error in /etc/netgroup --- %s G \G \<G \/etc/resolv.confrdomaindomaindomainnameservernameservernameserverLOCALDOMAIN%s.%sG \  |G \xdr_bytes: out of memory xdr_string: out of memory G \ 6 j  @ ,G \     /shlib/libc1_s .filegcrt1.s.textHH.text.initA> .filegLYClean.c.text<&.filegLYShowInfo.c$3temp.6A>D@.text.filegLYEdit.cO^table.2@.text<'.file3gLYStrings.co~@@XYdisttA?@@prev_pos*:b;@ @ phelp.60@ LYClosetA> Ap,Lt.text2&.file>gLYMail.c;NJN[Ncmd.4A?jyNx@ y0.textN*.fileLgHTAlert.cydyd@ first.15A?last.16A?A?@ line.19@ units.20@ @ .textyd&.file~gGridText.c((@ <+@ HD@ ^\@ bq@ f@ TpjA? @ (@ BOdZ.fy̾ߞ."*-@ :@ H@ T@ h@ wACAC@162<T UWZR3n.text(.filegLYGetFile.cAzPza.textzz.filegLYMain.cs@ @ terminal@ @ @ @ @ @ argcmpargncmp<pgmAC)6KvYlauth_funbase_fun<v 2Hhelp_fun$ #0@R<chn|{Usage.76@ r&R ͼ@ !4<B@$.textU|.file'gLYMainLoop.cSbsametextNewline@:s@>@B@F@J@NnewdocAEACcurdocAE  T *l 8N Hb ` s      j f & ! D 9  O#6 c*~ x+D ,  , - / 1 2 3 6 (6 B9T [; q;v < > C4 D E G G I8 $K^ 4M MM dNv tO P P QH R> T T V Z "[ 7\ J\ _] o`j ` b$ c  cr d$ d| e*ef0gFhZjqjkm(mnopr0tC.textl G.file0gLYCurses.cO^o@Q|AFdumbterm.text .file?gLYBookmark.c  @TBAF AG|have8bit!Z3 .text .filebgLYUtils.c=L]@XHomeDir@\oly_tempAH6B,lineno@ffake_zap@jlast.26AHnFfirst.69@n@pAHAH@t@ @mf.84AH"#AH&0AH*<AH.H@T:^;ly_uip@mAH2.text.filegLYOptions.cRpRpR~Sadd_itTaddlblTDfZAH:AJ:first.24@-=MWbo}@@@@@@@@@&@4@F@Y@l@2@6@:@>@b@f@j@@@4@H@X@m@{@@@"@&@*@N @R@V,@Z7@^N@be@f}@j@n@r@v@@@@@'4ALXg@.textRpv{.filegLYReadCFG.csPPis_trueVzɨʾ&̈VΈ!΢:μLf T|ntable.36@Ъ Ҕ)F;Ob6s֞׬ @@ j@ n#1@ r;G@ vS@!v_Lo.textPK|.filegLYSearch.cAL:first.5@"x.text_.filegLYHistory.c@"@"ANV"AN:/ANv:ANrFANzT@"`@#l@$to_stack7NwAN~9.text P.file gLYForms.c<<KB@$AGpaddstrHAO AQfirst.16@$.text<).file gLYPrint.c f/fnames.2@$@ASKfWgLjh\xik>m$@$r~uy@$.textf 8+.file0gLYrcFile.c->@%Q@%_@&o@&(}@&HgetBoolputEnum<getEnumfF.text>.file8gLYDownload.cńń@&x@'x.textń x.file@gLYNews.c2.text.fileXgLYKeymap.c*9revmap@2funckey@5ekmap@6Hbuf.2AS.prettybuf.5ASLJpVesASnASvASxASASASbuf.38ASjL.text#0.filemgHTML.cHH@7@7),@ L DXbizstylesAS־Rx˞.textH .fileygHTFWriter.cTTTצ)9PHvXB.textT8.filegHTInit.cbqCleanse>@7. "2 )  3!".text5.filegDefaultStyle.c =$4 L$4tabs_8$4 ]@7 k@8@ |@8 @8 @9 @9` @9 @9 @:8 @: @: @;!@;X!@;!"@;!/@<0!;@(!@>p!@>!@?!@?H!@?!@?!@@ "@@h".@@"F@@"^@A@"v@A"@A"@B"@B`"@B"@B"@C8"@C#@C#@D##@DX#3@D#C@D#S@E0#h@Ex#{@Esheet@Fresult@F.text$4 .filegLYLocal.c#'#'#@F#,Zok_stat,ok_lstat-#-#.LYExecvhD#/,#/$0$2N$ 5$,b$97$IH.$YwD%Iwh.textp p-.filegLYexit.c%Xw%gw%x@KV%AX%x.textwT .file gLYJump.c%y%ybuf.8AY%,%.texty Tp.filegLYList.c%8%8%AZ&@K`.text8 p.filegLYCgi.c&$&$env@Kd&/@Khenvc@Klalloced@Kp&9$&J`&`.text$|.file'gLYTraversal.c&j&y&&.textl).file3gLYEditmap.c& & &@K&@N&@P'@S@' @Ud'@Uh.text x8.file@gLYCharSets.c'%'4'E@U'P\'f''v'@c'.text;.fileLgLYCharUtils.c'4'4'A[(A[(A[(A[*(&<hex@e.text4E0.fileVgLYMap.c(8d(GdLynxMaps@e (X!(h"(u$.textd\{.fileqgLYCookie.c(+(+(@e (@e$(@e((+(,p(,(-x(-)0T)5)%;)9@e,)PA[>path.23A\>name.24A]>value.25A^>what.26AnB)ZAnJ)dAnR)q@e0)d.text+ED.fileygLYExtern.c)q)qs_str.2Anbformatrl.textq.filegLYStyle.c)s)s.texts.filegLYHash.c)s)s.texts.filegLYPrettySrc.c)s)s.texts.filegTRSTable.c*s*s*/s*<t*NyV*ez&*z*****.textsl.fileSgUCdomap.c*++B+3B+O@e+e8+F+F+++,@e,),H,d,,,,.,<-<-.-M-i----@f--. .@fJ...F.[.p...@f.../@f//*/?/Tp/l~/~/2/@/@//00020Arepl_map@f0P0b0y0@0d0r0r01 1#1=@v1Q1n11@1J1X1X22$2>2XV2ud2d2@2223B3+P3EP3_@3s333@ 3X3f4f4)@4=4Z4u4@44445&5-&5C5\5u5@555@5"b6"p6#p6*%,6A%:6a@|6{-6-6.6@6/6/7 0727827N37d57}@*7@*7@.7@27@B757A~7<*76@8 686UCInfoApl8.@F8G@J8d@N8p@8@N8@R8@V8@Z8@^8@9@^9"@b9:7j9M8"9d89u99:@9;9:9<9=9@UC_MapGN@9G: Apb:H(:$M:AAdummy.55Apf:_M:xP:S:T:Apj:Aph.textZ.fileYgUCAux.c;d;d.textd.file_gUCAuto.c;'m;6m.textm\.filejgHTParse.c;Gn;Vnscannn;g|hex@from_hex~crfcX.textnS.fileygHTAccess.c;t;;@;@;@;*;hHTLoad; hexD;Z.text@.filegHTTP.c<<<#.text)H.filegHTFile.c<.<= >@>( >@ >W X>t h> response `>A> > > Z> <> >@> ? ?A?' ?9A"?EAmonths@?R !vTheDateA ThisYearALastYearA?e "|? "base.44A?@? #? %? &"? (? ,? .@ 2@ 7@5 ;@DA&.text W.filegHTTCP.c@Q [@` [hostname@string.6A0@q ^d@~ g.text [.filegSGML.c@ n@ n@ n@ o@ p:@ q A q`A"@A. rA<ADAH tZAW uAi uLAx uA vA vA w.A w^A wA xA xA {bA B BB B B- B9 $table.54@BD BP nje.77A@B_ .text nLT.fileIgHTMLDTD.cBi Bx entities@ a_attrABAHBAlBABABABA8BAxbq_attrABABAcol_attrA@BAxdiv_attrACAfig_attrAC A\fn_attrA|CAC#AC-AC8A,gen_attrA8CFAXh_attrA|hr_attrACTAimg_attrA C`ApCkACxACA8CAdCACAmap_attrACACA<CALCATCACACA CA Pp_attrA D A DA D A 4D,A tab_attrA D7A td_attrA 0DBA tr_attrA DPA tags_old Ltags_new tagsA.text 3d.fileOgHTChunk.cD[ @Dj @.text @.file]gHTPlain.cD{ PD PDA |D PD D ND DAE E .text P o.filergHTMLGen.cE% E4 EE ER *E` lEl E E LE E E bE E E F  F .F- .text  %.file}gHTAtom.cFC FR FcA FoA8n1.4A t1.5A Fz .text h.filegHTAnchor.cF F F FA F F 2F fF .text @.filegHTStyle.cF #0G #0.text #0x.filegHTList.cG %G+ %.text %.filegHTString.cG< *GK *HTAlloc 1G\A GgA GrA G}A dummy.24A G 1G 8Z.text *\.filegHTRules.cG :G :rulesA GA G =t.text :.filegHTFormat.cG O(G O(HAHAH!AH-AH; R^HF SHY `@Hq `H `H aH aLHA H aH aH aI bI$ bI8 b"IKA.text O(d.filegHTMIME.cI` bIo bpumpData dI qI I ^I I JI HTMIME HTmm64A IA 2HTmmcontA D.text bD.filegHTNews.cI (I (NewsHostA TNewsHREFA XJA \JA `rawtextA dJA fnameA jaddressA ndbufA rJ' (J:A vJF VsAresponse JQAmatch tJ_ Jp FJ| .J targetAJAJ @J J J J JAJ :J K K K$A,K/ ZK9 "KD KOA(.text ([.file gHTGopher.cK[  Kj  K{A KA K dKA\hex from_hex K targetA4KA8K 8K &K K K L :L rL% L: LKA LW #Li &L} /.L 2.sA0L <<.text  ?#.file)gHTTelnet.cL CL CL C L EL IZ.text C+.file6gHTFinger.cL JL JMAtM JsA\M J&targetA`M*Adresponse K.text J.fileDgHTWSRC.cM6 XME Xpar_nameAMV ZBMo \@M~ ]JM bM bM bM cN.text X H&.filedgHTAABrow.cM dM dMANANAN9A NFANQAN_ANpANANA"NA&NA*NA.NA2N e\N eN jO fO! h@O2 iO@ jOZ jOk kTOy lxO pO q.text d7.filevgHTAAProt.cO ~O ~OA8OA<OA@isNumber ~O NP ,P P!ADP+AHP5ALPI PW 6.text ~p.file|gHTAssoc.cPe Pt .text .filegHTLex.cP DP DPATcacheAXlex_cntAPAmsg.6A.text D.filegHTUU.cP P six2prA\first.4Apr2sixA.text  .filegHTAAUtil.cP P bufferAin_socAQAQAQA.text M.filegHTGroup.cQ* lQ9 lQJ QW Qj Qz Q Q JQ Q Q Q JQ bQ .R R RR R. R< @RKA.text ltn.filegaddch.c.text _ac_rA.filegaddstr.c.text @_ac_rA.filegbox.c.text _ac_rA.filegclear.c.text |8_ac_rA.filegclearok.c.text 0_ac_rA.filegclrtoeol.c.text _ac_rA.filegcrmode.c.text _ac_rA.filegcurses.c.text _ac_rA.filegdelwin.c.text X_ac_rA.filegecho.c.text _ac_rA .filegendwin.c.text ,_ac_rA.filegerase.c.text _ac_rA.fileginitscr.c.text d _ac_rA.filegminiinit.c.text "_ac_rA$makenew .filegmove.c.text H_ac_rA0.filegnewterm.c.text D0_ac_rA4.file gnewwin.c.text t _ac_rA8.filegnoecho.c.text _ac_rA<.filegnttychktrm.c.text (_ac_rA@_stupidAH_unknownALchk_trm .filegreset_prog.c.text H_ac_rA.file gresetshell.c.text H_ac_rA.file%gsavetty.c.text (_ac_rA.file*gscrollok.c.text <_ac_rA.file0gsetbuffred.c.text P_ac_rAR\A.file7gsetupterm.c.text 0D_ac_rARiARuA .file<gtouchwin.c.text D_ac_rA.fileBgtputs.c.text L4_ac_rA_tpad .fileGgtstp.c.text _ac_rA.fileLgunctrl.c.text ,_ac_rA.fileQgwattroff.c.text ,(_ac_rA.fileVgwattron.c.text T$_ac_rA.file[gwrefresh.c.text x_ac_rA.file`gwstandend.c.text ” _ac_rA.fileegwstandout.c.text ´$_ac_rA.filejg_c_clean.c.text  _ac_rA.filepg_delay.c.text t_ac_rAtmspc10A.fileug_ec_quit.c.text 0_ac_rA(.filezg_fixdelay.c.text 8_ac_rA,.fileg_hlmode.c.text _ac_rA0.fileg_init_cost.c.text d_ac_rA4.fileg_kpmode.c.text ɰd_ac_rA8.fileg_ll_move.c.text x_ac_rA<.fileg_outch.c.text ˌ _ac_rA@.fileg_pos.c.text P_ac_rAD.fileg_setwind.c.text pL_ac_rAH.fileg_syncmodes.c.text μ_ac_rAL.fileg_tscroll.c.text _ac_rAP.fileg_window.c.text `<_ac_rAT.filegcbreak.c.text Ϝ@_ac_rAX.filegcntcostfn.c.text p_ac_rA\counterA`.filegdef_shell.c.text Lh_ac_rAd.filegdoupdate.c.text д_ac_rAh.filegfixterm.c.text Ѥ_ac_rAl.fileginitkeypad.c.text Ѵm_ac_rAp_addone .filegline_alloc.c.text Ll_ac_rA .filegll_refresh.c.text ٸ(_ac_rAR T.filegm_tstp.c.text x _ac_rA.filegmakenew.c.text X_ac_rA.filegmvcur.c.text 8_ac_rARA RAR R R _loc_up ".filegtparm.c.text ,\_ac_rARA_err .filegwnoutrfrsh.c.text  _ac_rA.fileg__cflush.c.text _ac_rA.fileg_clearhl.c.text L_ac_rA.fileg_comphash.c.text |_ac_rA.fileg_id_char.c.text x,(_ac_rAR "R .fileg_inschars.c.text _ac_rA.fileg_insmode.c.text T_ac_rA.fileg_line_free.c.text l_ac_rA.file"g_reset.c.text _ac_rA.file'g_scrollf.c.text _ac_rA.file,g_sethl.c.text p _ac_rA.file1g_setmode.c.text 8t _ac_rA.file6g_shove.c.text  _ac_rA.file;gchktypeahd.c.text @ _ac_rA.file@gclreolinln.c.text r_ac_rA.fileEgidln.getst.c.text |:_ac_rA.fileJgshowstring.c.text p(_ac_rA.filePgvidputs.c.text F_ac_rA<oldmodeA@.fileUgwritechars.c.text !t0_ac_rAD.fileZg_blanks.c.text $0P-_ac_rAH.file_g_delchars.c.text &4_ac_rAL.filedg_dellines.c.text '`D_ac_rAP.fileig_forcehl.c.text +_ac_rAT.fileglibgcc2.cR +0S +0S zNO_REGS S S' FP_REGS S1 S> SN ALL_REGS S^ .eosfmSn VOIDmode QImode HImode PSImode SImode PDImode DImode TImode OImode QFmode HFmode TQFmode SFmode DFmode XFmode TFmode SCmode DCmode XCmode TCmode CQImode CHImode CSImode CDImode CTImode COImode BLKmode CCmode S{ .eosfzS S MODE_INT S S MODE_CC S S S .eosfS size_t wchar_t UQItype SItype USItype DItype UDItype SFtype DFtype XFtype S DIstruct highlow.eosf.0fake s ll .eosfDIunion func_ptr T +0$ >T.bf +0e.ef +HeT +P$L>Z.bf +Pe.ef +eT*A.__main +$>`.bf +e.ef +e.text +0.file 4glibgcc2.cT8 +TG +TX NO_REGS Tb Tl FP_REGS Tv T T ALL_REGS T .eosfT  VOIDmode QImode HImode PSImode SImode PDImode DImode TImode OImode QFmode HFmode TQFmode SFmode DFmode XFmode TFmode SCmode DCmode XCmode TCmode CQImode CHImode CSImode CDImode CTImode COImode BLKmode CCmode T .eosfT  T MODE_INT T T MODE_CC U U U( .eosf U7 size_t wchar_t UQItype SItype USItype DItype UDItype SFtype DFtype XFtype UA DIstruct  (highlow.eosf ".0fake  /s  "ll .eosf (DIunion  (func_ptr .text +.file glibgcc2.cUK +UZ +Uk  ENO_REGS Uu U FP_REGS U U U ALL_REGS U .eosf 8U  fVOIDmode QImode HImode PSImode SImode PDImode DImode TImode OImode QFmode HFmode TQFmode SFmode DFmode XFmode TFmode SCmode DCmode XCmode TCmode CQImode CHImode CSImode CDImode CTImode COImode BLKmode CCmode U .eosf EU  rU MODE_INT U V MODE_CC V V( V; .eosf fVJ size_t wchar_t UQItype SItype USItype DItype UDItype SFtype DFtype XFtype VT DIstruct  highlow.eosf ~.0fake  s  ~ll .eosf DIunion  func_ptr exit +$&>f .bf +estatus status.ef +e.text +(.file gaux-exit.cV^ +Vm +_exithk +$>l .bf +e.ef +e.text +.file glocale.c.text +1V~AXV /pVApVApVAV ..file gmalloc.cV 0lV 0lrcsidAspare.2A2nspare.3A6grabhunk 0.text 0l d.file gsetenv.cV :W :WA:.text :.file gstrerror.cW" <W1 <ebuf.2A.text <.file ggetmem.cWB =|WQ =|rcsidAWbA>WmAB.text =|.text >.file gcopyright.c.text >_ac_r.file gprintf.c.text >_ac_r.file gdoprnt.c.text >7_ac_rieee_cvtW{_dowrite.file gecvt.c.text >_ac_rcvt\buf.file gfprintf.c.text >t_ac_rt.file gsprintf.c.text >`_ac_r`.file gstrncat.s.text >4.file gaccess.s.text >noerror .file gcerror.s.text > .file gclose.s.text >noerror .file gchmod.s.text >noerror .file gfcntl.s.text >noerror .file gfstat.s.text >LS%1.file ggetpid.s.text >.file gioctl.s.text >noerror .file #gkill.s.text >noerror .file (gopen.s.text >noerror .file -gread.s.text >noerror .file 3gsbrk.s.text >@noerr1noerr24.file 8gstat.s.text >LS%1.file >gtime.s.text >noerror nostore.file Cgwrite.s.text >noerror .file Ggstrncmp.s.text >@.file Lgfgetc.c.text >4_ac_r4.file Qgfgets.c.text >_ac_r.file Vgfilbuf.c.text >_ac_r.file Zgstrncpy.s.text >8.file _gfputs.c.text >@ _ac_r@.file dgfputc.c.text >H_ac_rH.file igfread.c.text >_ac_r.file mgstrrchr.s.text >.file sgfopen.c.text >p_ac_rp_endopenV.file xgisatty.c.text >0_ac_r0.file }gfwrite.c.text > _ac_r.file gatof.c.text >_ac_rpow1_25.file gflsbuf.c.text >_ac_r.file gatoi.c.text >_ac_r.file ggetenv.c.text >_ac_rnvmatchB.file gmktemp.c.text >_ac_r.file gsetbuf.c.text >_ac_r.file gstrchr.s.text >.file gmemcpy.s.text >P!.file gmemccpy.s.text >,.file gmemchr.s.text >,.file gmemset.s.text >X!.file gstrcat.s.text >.file gstrcmp.s.text >(.file gstrcpy.s.text >.file gstrlen.s.text >.file gldexp.c.text >,_ac_r,.file gungetc.c.text >`_ac_r`.file gatol.c.text >_ac_r.file gexit.s.text >.file gaccept.s.text >LS%1.file gfork.s.text >forkok parent.file ggeteuid.s.text >.file ggetuid.s.text >.file gumask.s.text >noerror .file gbind.s.text >LS%1.file gconnect.s.text >LS%1.file ggetsockname.s.text >LS%1.file glisten.s.text >LS%1.file gselect.s.text >0LS%2&.file gsocket.s.text >LS%1.file ggetgroups.s.text >LS%1.file gmkdir.s.text >LS%1.file glstat.s.text >LS%1.file grmdir.s.text >LS%1.file #greadlink.s.text >LS%1.file (gtruncate.s.text >LS%1.file -grename.s.text >LS%1.file 2gsigblock.s.text >LS%2.file 7gsigsetmask.s.text >LS%2.file =gwaitpid.s.text >0LS%2(LS%1&.file Bgftell.c.text >_ac_r.file Ggclosedir.c.text >H_ac_rH.file Lgopendir.c.text >_ac_r.file Qgreaddir.c.text >_ac_r.file Wgabort.c.text >8_ac_rApassA.file \gaddr.c.text >@_ac_rA.file `gassert.c.text ?.file egbsearch.c.text @_ac_rA0.file jgbstring.c.text At<_ac_rA4.file vgclear.s.text ALS%1 B8LS%2 ALS%3 Bzeros% B:LS%4 ALS%5 B*LS%6 B"LS%7 B0.file {gcompatmode.c.text Bp sccsidA8.file gctype.c.text B|.file gdata.c.text D_ac_rAX.file gerrlst.c.text D_ac_rA(d.file gexecv.c.text D _ac_rA2 .file gfdopen.c.text E_ac_rA2$.file ggetcwd.c.text E _ac_rA2(.file ggetday.c.text Fx.file ggetgrent.c.text G, `_ac_rA2<_grjunkAzGROUPA2@matchgid RW KW QW Lgrskip IW Nsave OW LW MW ODW NW MLgidof SX SN.file ggethostent.c.text T$ MhostdataAXAhostbufAHOSTDBA2alignAŒX& T$X0 TpX: [XF ]XP ]Lany _.file ggethostname.s.text _LS%1 `.file ggetpwent.c.text `_ac_rA2EMPTYA2__pwjunkAŖ_pwjunk `pwskip dLX\ oXf h8matchuid iXp rbX~ nX kX lX tfX lTsave s X rX muidof k.file ginitfpu.s.text t.file ginnetgr.c.text t*_ac_rA5plookup y:doit uinlist xmakekey z .file glocaltime.c.text zX P_ac_rA6lGMTA6plclmemAŢgmtmemA޲XAXAdetzcode zXY zYA6YA6tzload {:getzname ~\getnum ~getsecs Y, getrule FY6 ptzparse rgmtload localsub timesub @gmtsub Y@ ~tmcomp ftime2 time1 .file gntoa.c.text dp_ac_rA7$.file gperror.c.text  _ac_rA74.file gpopen.c.text _ac_rA7LYJA&.file gputenv.c.text x4 _ac_rA7`reallA7dfind 0match x.file $grand.c.text @_ac_rA7hrandxA7l.file (gremove.c.text .file -gres_comp.c.text  dn_find .file 1gres_query.c.text X+.file 7gres_send.c.text xTLsA7no_addrAv.file <grew.c.text T_ac_rA7.file Agscanf.c.text _ac_rA7.file Ggsigcall.c.text _ac_rA7sigtabA.file Kgsigcode.s.text <.file Rgsleep.c.text 0_ac_rA7envAawake &.file Wgstrcasecmp.c.text DcharmapA7.file [gstrpbrk.s.text  .file _gstrstr.c.text `.file egstrtod.c.text x _ac_rA8pow1_25A8.file jgstrtok.c.text t_ac_rA8.file ogstrtol.c.text  _ac_rA8.file {gsyslog.c.text  HlognameA9cttyA9 LogFileA9LogStatA9LogTagA9 LogMaskA9$YTA9(Y`AB.file gsystem.c.text  _ac_rA9T.file gttyname.c.text  _ac_rA9hrbufARdevA9lsxtA9r.file gyp_bind.c.text YkA9YyA9YA9my_addrArYAvYAzYA~bfnameAbfAYAnewborn (Y hY Y Y Z (Z Z" DZ- Z= ZK .file gyp_enum.c.text Ũ ;_ac_rA9ZVA9ZfA9Z} ƐZ v1filter v2donext v1donext ̪.file gyp_match.c.text ψ@4_ac_rA9headAZ ψfreenode ϶makenode &Z nZ Ԗ.file gypprot_err.c.text _ac_rA9.file gypv1_xdr.c.text `_ac_rA:.file gypxdr.c.text  _ac_rA:D.file gctype_def.c.text ِ.text ِ.initA.file gmalloc_def.c.text ِ.text ِ.initA .file gstdio_def.c.text ِ.text ِ.initA@.file genv_def.c.text ِ.text ِ.initA0.file glseek.s.text ِnoerror .file gunlink.s.text ِnoerror .file gfseek.c.text ِ_ac_r.file gfindiop.c.text ِD_ac_rD.file gsignal.s.text ِnoerror .file gmemcmp.s.text ِ8.file gfrexp.c.text ِ\_ac_r\.file galarm.s.text ِ.file gdup.s.text ِnoerror .file gexecve.s.text ِ .file gpause.s.text ِnoerror .file gpipe.s.text ِnoerror .file &gwait.s.text ِnoerror nostatus.file +grecv.s.text ِ(LS%2.file 0gsend.s.text ِ(LS%2.file 5gsendto.s.text ِ4LS%2*.file :gsetsockopt.s.text ِ0LS%2&.file ?gZ.text ِLS%1.file Dgflock.s.text ِLS%1.file Igwritev.s.text ِLS%1.file NgZ.text ِ(LS%2.file Sggetcompat.s.text ِLS%2 .file Xgsigvec.s.text ِ LS%2.file ]ggettod.s.text ِLS%1.file bgseekdir.c.text ِx_ac_rx.file gg_sysm68k.s.text ِnoerror ٜ.file lgasctime.c.text ٠_ac_rA:`.file xgclnt_udp.c.text P*_ac_rA:udp_opsA:Z Z Z Z [ [ .file gdoscan.c.text _ac_rA;$setup string number 2.file gdup2.c.text  _ac_rA;(.file gexecl.c.text P _ac_rA;D.file ggetnetgrent.c.text p6_ac_rA;H[*A grlistAdomainAoldgrpAdoit match fill 6.file gindex.c.text H _ac_rA;.file gpmap_gtprt.c.text h _ac_rA;timeoutA;[4A;.file gpmap_prot.c.text xh_ac_rA;.file gres_init.c.text -.file gres_mkquery.c.text .file grpc_prot.c.text x_ac_rA=|[?A=accepted rejected Z.file grpccomndat.c.text H.file grpcdtblsz.c.text H$.file gsetjmp.s.text l\LS%1 L1 L0 .file gstrspn.s.text $.file gxdr.c.text  _ac_rA=xdr_zeroA=.file gxdr_mem.c.text _ac_rA=[KA=[V 6[e j[t [ [ [ @[ [ ,.file grecvfrom.s.text 4LS%2*.file g[.text LS%1 .file gtelldir.c.text (_ac_r(.file gauth_none.c.text < _ac_rA=opsA>[ [ [ \ \ \0A..filegbindresvport.c.text   .text .initA2_startH__istart initfpu tmainrenviron@splimit%@\A Bp\Nsignal \Z@ \d\{@ .cleanupprintfG!b_iobA\fflushG \z\@ YLYexitx\F\@ free 5\@PLYlines@ FstdscrA6wmove \ \wrefresh x\]@ ]@ ]$]nhist@ VhistoryA:]3t]Cstrstr ]V6]f]tshowinfo ]~@ *]@ ]@]E^]>JHTAlerty~]L|nlinks@ RlinksB:is_urlstrrchrG!strlenG!fprintfG ]|]@ ]TlstatG"^ A errnoG ,TraceFPreadlinkG#BsprintfG!^ ^& Hctime bstrcatG!^5LYEntifyNHTSACopy ,p^A^Y@ $^f ^~ !^>^^^@ 0^^  ^@ _Pr_N_*D_6editor@ _J^_\_j{strchrG!_t$fopenG HTParseq~fcloseG _ 8_ 9V_ :B_@ _CC:sleep LYSystemQ_____LYcols@ J`strncpyG!``V`2HTCJK@isascii Cena_csi ~`? _filbufG `K@ (`]P_ctypeATLYgetch&`n&`z@Utolower C`'toupper C`'f`'`'`(`(B`(z`(`(a ٪a +a!a0TaB)ZLYEdit1*aN@Ua_@bmustshow@daq a|1waddch a@[a@waddstr aLYgetstr5aaCC>aCC@a@(xkeymap@(|a7b@Kb@ b@ULYstrsep8strpbrk LYstrstr9 UPPER8Lb1 *b?9rbZ:bg:,strncmpG!bu;b<b>.SNACopy@2calloc :outofmemySNACat@realloc 8memcpyG!Jb@UbC`bMfgetsG HTSACat ,mailformPnb{,LYNoCc@ b@ c@ c @ c, 6popen pclose c7mailmsgZVcB@ fputsG cN<c`<perror cmcc{ 6cDc@Uwclear |scrollok <c@ ZcstrcmpG!c@ cc^cd@ ~d VfreadG fwriteG d8Pd.d;ydI8InfoSecsCCBdY|dd|do}6timeG!d~@ "dddHTPromptdZd d@ ,e @ 4e>e(@ e5@ eHcrawl@ e^CCFeh@ (er@ ,e@ 0e@ 4e@ 8e@ @e@ De@ Le@ Pe@ Te@ Xf @ \bold_on@ ]f@ f(Mmalloc 3 fA *fN *Vf^ )Jftff !f &fhfPff %f ) g 'jg@ g% )g>G|gJ@ gX gc@gr ggtgQmemsetG!PgCCJg@ g@4g@6gg "Fh h @ Fh/4wattron ThD@ 4wattroff ,hShilhuh PhCGNTO_EUC TO_SJIS hPBhh@ LYNoCore@ _assert ?hh i Pi" 6i3@ i@diJ@ curscrCGRclearok iUigpi~Xiiini`i Fi@ i j j j,ɼj>jPjfj}jfjtjjsjjjkkk(Tk:kNk^~kqkkk,kk|k@ Bkl@ lJl$l7lBlSlelzllllllm.mNm( m:mU mk m +8m m m 4mm@ m m@ /n n$n7nF,nTLnhbnzxnnnnn\nno@ o@7o(o;joLro^zosooooooop0pstrcpyG!p-@ HTSearchp>@ fputcG pNCGVpXbnolist@ 5pj"pt Np p p p 0p p Np q fq*q3 ~qMJq` qsqNq&qRqqrr# r80rQrhr|rr rbrrfr 's <s!\s4sDsRsdswPs@ ys'atoiG NsJsejs .s -strtod xs7ts@rtfRstrtok t&t@tN~tYN tiO|tP,tP\t@ @tRtRmore@ Zt^Dstrerror =t statG!remove werase strncatG!uguiu'Vu3@ ~u?@ uM0uXZufu|8ux4uyuyuyuyuyvyv@ getfile~v*@7v;@vP@v^@7vp@sscanf jv@ :v@ ;v@ v@ v@ v@ v@ $v@ v@ #v{w@w@ w#w5@ wIw[@ |news_ok@ Hwgwvw@ wSHw@ iw@ jw@ w@ w@0w-|no_mail@ }x x x) x:@ xJxXxg@ Gxq@ RgetenvG x`x@ IxLYpop'ftp_ok@ KHome_Dir/wwwNameJxOx.dx@x@ {x@ hx@ ny @ gy@ iy%@ jy1@ ky@@ lyM@ my[@ qyj@ ryw@ sy@ ty@ uy@ vy@ wy@ xyΦyy&z Otz@ z'@ tagged@ z6@ zJ@ z_@ printers@ zu@ z@ z@ z@ z@ z@ z@ z@ z@ z@ z@ {@ {@ {+@ !{<@ %{H@ &{T@ '{`@ 1bold_H1@ 2{m@ 3{@ 6{@ 7{@ 8{@ 9{@ <{@ ={@ >vi_keys@ ?{@ @{@ J{@ L|@ M| @ N|5@ O|B@ P|S@ Q|e@ S|t@ T|@ U|@ V|@ W|@ Xno_shell@ [|@ \|@ ]|@ ^|@ _no_print@ `|@ a} @ bno_exec@ c}@ d}!@ eno_goto@ f}-@ o}>@ p}O@ yno_jump@ z}b@ }o@ }@ }@ }@ jumpfile@ }@ }@ }@ LynxHome@ homepage@ }@ }@ helpfile@ }@ }@ ~@ ~@ ~.@ ~>@ ~S@ language@ ~j@ ~w@ ~@ ~@ ~@ ~@ ~@ ~@ ~@ ccount@ ~@ @ @ )@ 8@ $F@ (V@ <c@ =@ >@ D@ E@ N@ ^@ `@ d@ h@ k@ l/@ m?@ nR@ pd@ tv@ x@ z@ {@ |@ }@ @ @ @ @ -@ G@ ^@ u@ @ @ @ @ Old_DTD@ @ @ @ @ *@ <@ T@ j@ @ @ @ @ @ @ @ @ 3@ G@ drN +CGZCGA putenv xgetuidG"mktempG!VmkdirG" gh2 dLATIN1@z%x7/C0read_cfgread_rcSLfz Z&tVr 4setup mainloopy|-@E@7Re@Kto@e|@ep@$Rpsave_rc@j@vR*A HA L-:7@C$\@f*s@KTabort >CH*@(@,:JX$lookup0b,A'7L_ ~s  [?,Ŵ]prLYpush"*HvJThead@K\LYJump~showlist*: @\ L* <"JcCH.s@UAQtagflagNDf|ln&&2v9s2L4W *dqr8fshowtagsO @-&Dfmt_keys7LYboxibox initscr crmode noecho jecho endwin ,/R ttytypeCH2setterm tLINESCHCOLSCHtouchwin =H_w $Lt)@CHchmodG xN?[PRrenameG#`fy̆ ´ ”dE @`4@ Fxbzero AselectG#l3f?|L(drxb  Httyname ioctlG!getpidG!srand rand DHTEscape}V $ ,\0 bJ@@ Py*[NLYDoCSI/<getcwd EgeteuidG"getpwuid aLYmktime4openG!\fdopen EumaskG$i<v==truncateG$zrmdirG#fG&IJRKMr TOO\ Osystem .=@ZN@Ux^@k@Uy4newwin tdelwin P@"@c{bremap(strtol 9HZ[Hj Nv Ox H,unsetenv <do@"|) Vb=4 82TO_JIS z&>3FZQdw|z@e ~  fHTML_dtd f^#4.? Y f$s^ f    OL_VOID@e@e"9jP@g~J j@  >d F@U)'"6 $BLYstylesϨCHTML_newlT bhtivӬSGML_new HTMLToCpը_flsbufG $ "ނ^6`(A 88G V Ppf bt ( c WatofG HatolG T &F &fgetcG ungetcG! %0 #jdefmenu@Fc:<LYUploadj{ )forkG"Xexecv DwaitpidG$LYLeaksp"r/s6DsQt_tjuvwvRLYatexitwyzbsearch @readG!zcloseG ~@Ul@Wl@Y,@@f.zUCInitZC@Q p` lDl=> @ bVR  .d@!6O@_ (NLYCookieXuq@e|@e@f@nUS_ASCII@~UTF8@@AH R^ e>j4k<GmHTStripn`@m@HTSecure@w@@HTTP@HTTPS@HTFile@HTTelnetAPHTTn3270AhHTRloginA\HTFTP@HTNewsA xHTNNTPA A A HTSNewsA A A HTGopherA6HTCSOABHTFingerAv @. l Z H  6+R8@N ^mzJ i  sfwriteG!HTDoRead m` y b\HTCopy Z`@@тB 0B QrQA o Q{ \ socketG$DG" \bindG""listenG"mktime D acceptG" ] \X ]h_errnoCH WR d >@ _connectG"4isattyG!  A L& 69 \D@O 8\ i u d @   A xHTPlain    D P 6 *K ` r .  # # $ $ %p 7<HTBinDirA  A  ;% Z ~Pf u ~ lex TCHunlex D    \AP  getpwnam `hgetgrgid G^getgrnam G" 6. h: J Z &l  6 z  _ac_sG \_unctrlA_tscroll SPCHcbreak ϜDef_termAACHcur_termAlwinCKz_endwinAcfree :doupdate д 8_outch ˌtputs L_pos _c_clean  newterm DAD_ec_quit  % psavetty _new_tty / m_tstp gettmode ? $_tstp makenew XI PV Ѵc setbufG!getsh accessG Bo L_delay t_ll_move sigblockG$ ~G$,killG!&fixterm Ѥ _hlmode _kpmode ɰ_window ` μfcntlG _cost_fn tparm , LCK~_clearhl _setwind pmvcur _sethl _setmode 8  ٸCKCK_reset  l _scrollf _id_char x__cflush _id_line |_shove  . p_clreol  &! @0 _insmode T_blanks $0: 'vidputs D _getst  N !t_forcehl +ZCKthCKt_cleanupG _exitG!vA .AtAxA| 0AAAA AA'A7AIA[Ak =uCK_findenv :setenv ;nbcopy Atsys_nerrA*A(hsbrkG! =mal_mmap =libc_iobG _doprntG  _bufsyncG fstatG #G memchrG!>_xflsbufG 62G ecvtG fcvtG =Sg-D[cerror%G frlibc_endG $brkG Z1EYmmemccpyG!8_findbufG G _wrtchkG 0)>SfreopenG _findiopG lseekG!2jldexpG!,G ftellG$fseekG G G   5OcG pfrexpG  5I]s$:Pi~ 7OfG"tbcmp AmemcmpG!Dclear ACLisalnum B|isalpha Biscntrl Bisdigit Bisgraph Bislower Cisprint C$ispunct C@isspace C\isupper Cxisxdigit Ctoascii C_tolower D _toupper D0 DD_smbufCM_lastbufA&\A&`execveG"@G"tzset 8timezoneA6|daylightA6 G,setgrent Hendgrent H rewind  IFgetgrent I Iyp_next yp_first Ũyp_match о  l( T2 X@ >K Z[ Y k u [B d [ \FCQ"setpwent cZsyslog endpwent c d  getpwent d tinnetgr t pindex HtznameA6t  gmtime asctime ٠writevG$pipeG#$execl PwaitG$unlinkG!dn_comp _getlong putshort putlong _resA;res_init  res_send x  f D$ /G#sendG#sendtoG#: XrecvG#NE *P scanf _doscan _sigcall [G"vsigvecG$8_sigcode _signalG *_sysm68k ِalarmG$setjmp lpauseG#longjmp e strspn openlog .closelog q seekdirG%|A9|A9  yp_bind flockG"R  ,dupG":dup2 G" P xdr_pmap x  0 xdr_void ) v7 ,J ׺Z e Ȑt ֐ ` l ( A: (A:$ v  ؚ ( 2 NH S |a lA:H} G (endCQR "7K_s*telldirG$@Wn ܔ} h  XCQ&   CQ6   x HrecvfromG#TNETGROUPA;L j! xdr_enum / B |UCQB_G"_setjmp _longjmp xdr_free xdr_int m 2xdr_long Jw xdr_char  xdr_bool J L etext edataA>_soriginCQRgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_ctempfile.9gcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cLYClosetTopmouse_linkset_clicked_linkhave_leventcsi_is_csikillbufferLYFindInClosetLYAddToClosetlasthelp_lineedit.58helpbuf.59unicode_to_lower_caseUniToLowerCasegcc2_compiled.__gnu_compiled_cSafeHTUnEscaperemove_tildespersonal_name.9terminate_lettergcc2_compiled.__gnu_compiled_ckb_units.14bytes_last.17transfer_rate.18conf_cancelledgcc2_compiled.__gnu_compiled_cHTCurSelectGroupCharsetHTCurSelectedOptionValuectrl_chars_on_this_lineutfxtra_on_this_linedefault_styleloaded_textsHText_haltmem_is_availLY_check_callocHText_getChartransInfoPerFormInfo_freeFormList_deleteunderscore_stringdisplay_linedisplay_titlelast_nlinks.24charset_last_displayed.25display_pagesplit_lineblank_linesHText_TrueLineSizeinsert_blanks_in_lineHText_insertBlanksInStblLinesHText_AddHiddenLinkremove_special_attr_charssame_anchor_or_fieldline_for_charadjust_search_resultwww_user_search_internalsHTFormActionHTFormEnctypeHTFormTitleHTFormAcceptCharsetHTFormDisabledHTFormMethodHTCurrentFormHText_skipOptionNumPrefixget_trans_qfind_best_target_cscleanup_line_for_textareaincrement_tagged_htlineinsert_new_textarea_anchorupdate_subsequent_anchorsmove_to_glyphgcc2_compiled.__gnu_compiled_cfix_httplike_urlsgcc2_compiled.__gnu_compiled_clynx_version_putenv_commandstack_dumpnumber_linksnumber_fieldsLYPrependBaseLYStdinArgsno_options_furtherLYStdinArgs_freetildeExpandparse_argFatalProblemparse_authenticationanonymous_funassume_charset_funassume_local_charset_funassume_unrec_charset_funcache_funchild_funcrawl_fundisplay_fundump_output_funeditor_funerror_file_funget_data_funprint_help_and_exithiddenlinks_funhomepage_funmime_header_funnewschunksize_funnewsmaxchunk_funnobold_funnobrowse_funnocolor_funnopause_funnoreverse_funnounderline_funpauth_funpost_data_funrestrictions_funselective_funsource_funtraversal_funversion_funwidth_funArg_Tableprint_help_stringsarg_eqs_parsehad_nonoption.95gcc2_compiled.__gnu_compiled_ctraversal_hosttraversal_link_to_addowner_addressownerS_addresstextinput_activatedTracelogOpenFailedLYReopenTracelogprev_targetset_curdoc_linkdo_change_linkdo_check_goto_URLare_differentdo_check_recalldo_cleanup_after_deletefind_link_near_colDoTraversalhandle_LYK_ACTIVATEshow_main_statuslineform_novicelinehandle_LYK_ADD_BOOKMARKhandle_LYK_CLEAR_AUTHhandle_LYK_COMMENThandle_LYK_COOKIE_JARhandle_LYK_CREATEhandle_LYK_DEL_BOOKMARKhandle_LYK_DIRED_MENUhandle_LYK_DOWNLOADhandle_LYK_DOWN_HALFhandle_LYK_DOWN_LINKhandle_LYK_DOWN_TWOhandle_LYK_DWIMEDIThandle_LYK_ECGOTOhandle_LYK_EDIThandle_LYK_DWIMHELPhandle_LYK_EDIT_TEXTAREAhandle_LYK_ELGOTOhandle_LYK_EXTERNhandle_LYK_FASTBACKW_LINKhandle_LYK_FASTFORW_LINKhandle_LYK_FIRST_LINKhandle_LYK_GOTOhandle_LYK_GROW_TEXTAREAhandle_LYK_HEADhandle_LYK_HELPhandle_LYK_HISTORICALhandle_LYK_HISTORYhandle_LYK_IMAGE_TOGGLEhandle_LYK_INDEXhandle_LYK_INDEX_SEARCHhandle_LYK_INFOhandle_LYK_INLINE_TOGGLEhandle_LYK_INSERT_FILEhandle_LYK_JUMPhandle_LYK_KEYMAPhandle_LYK_LAST_LINKhandle_LYK_LEFT_LINKhandle_LYK_LISThandle_LYK_MAIN_MENUhandle_LYK_MINIMALhandle_LYK_MODIFYhandle_LYK_OPTIONShandle_LYK_NEXT_LINKhandle_LYK_NEXT_PAGEhandle_LYK_NOCACHEhandle_LYK_PREV_LINKhandle_PREV_DOChandle_LYK_PREV_PAGEhandle_LYK_PRINThandle_LYK_QUIThandle_LYK_RAW_TOGGLEhandle_LYK_RELOADhandle_LYK_REMOVEhandle_LYK_RIGHT_LINKhandle_LYK_SHELLhandle_LYK_SOFT_DQUOTEShandle_LYK_SOURCEhandle_LYK_SWITCH_DTDhandle_LYK_TAG_LINKhandle_LYK_TOGGLE_HELPhandle_LYK_TOOLBARhandle_LYK_TRACE_LOGhandle_LYK_UPLOADhandle_LYK_UP_HALFhandle_LYK_UP_LINKhandle_LYK_UP_TWOhandle_LYK_VIEW_BOOKMARKhandle_LYK_VLINKShandle_LYK_digitexit_immediately_with_error_messagestatus_linkgcc2_compiled.__gnu_compiled_cfirst_time.6lynx_called_initscrgcc2_compiled.__gnu_compiled_cis_mosaic_hotlistshow_bookmark_not_definedfilename_buffer.4convert_mosaic_bookmark_filenewfile.7havevisibletitle_convert8bitMV_FMT.12gcc2_compiled.__gnu_compiled_clocalhost_aliasesFindTempfileByNameFindTempfileByFPgetenv_textnovice_linesDontCheckcompare_typenames_used.70used_tempname.71counter.72fmt_tempnamerestrict_namerestrict_flagfirsttime.83lastcheck.85lasttime.86lastsize.87homedir.104IsOurFileOpenHiddenFiledisplay_putenv_command.187gcc2_compiled.__gnu_compiled_cvalidate_x_displaysummarize_x_displayterminate_optionsboolean_choiceget_popup_choice_numberprev_target.22prev_target_buffer.23selected_stringdisabled_stringon_stringoff_stringnever_stringalways_stringbool_valuessecure_stringsecure_valuesave_options_stringcookies_stringcookies_ignore_all_stringcookies_up_to_user_stringcookies_accept_all_stringx_display_stringeditor_stringemacs_keys_stringkeypad_mode_stringkeypad_mode_valueslineedit_style_stringmail_address_stringsearch_type_stringsearch_type_valuesshow_cursor_stringuser_mode_stringuser_mode_valuesvi_keys_stringvisited_pages_type_stringvisited_pages_type_valuesDTD_recovery_stringDTD_type_valuesselect_popups_stringimages_stringimages_ignore_all_stringimages_use_label_stringimages_use_links_stringverbose_images_stringverbose_images_type_valuesmbm_advanced_stringmbm_off_stringmbm_standard_stringmbm_stringsingle_bookmark_stringassume_char_set_stringdisplay_char_set_stringraw_mode_stringshow_dotfiles_stringdired_sort_stringdired_valuesftp_sort_stringftp_sort_valuespreferred_doc_char_stringpreferred_doc_lang_stringuser_agent_stringPutOptValuesGetOptValuesbreak_datagen_optionsNewSecureValuetempfile.37gcc2_compiled.__gnu_compiled_cfind_colonfree_item_listadd_item_to_listfree_printer_item_listadd_printer_to_listconfig_enumassume_charset_funassume_local_charset_funassume_unrec_charset_funcharacter_set_funoutgoing_mail_charset_fundefault_bookmark_file_fundefault_cache_size_fundefault_editor_fundefault_keypad_mode_funnumbers_as_arrows_fundefault_user_mode_fundired_menu_funjumpfile_funkeymap_funlocalhost_alias_funlynx_sig_file_funnews_chunk_size_funnews_max_chunk_funnews_posting_funcern_rulesfile_funprinter_funreferer_with_query_funsuffix_funsuffix_order_funsystem_editor_funviewer_funnonrest_sigwinch_funConfig_Tablelynxcfginfo_urlconfiginfo_urllookup_configmypath.75do_read_cfgtempfile.80tempfile.83config_cache.84config_defines.85gcc2_compiled.__gnu_compiled_ccheck_for_target_in_linksprev_target_buffer.4gcc2_compiled.__gnu_compiled_cPrevVisitedLinkPrevActiveVisitedLinkLatest_lastLatest_firstFirst_treeLatest_treeLast_by_firsttempfile.12tempfile.17topOfStackbuffstackLYLoadMESSAGESgcc2_compiled.__gnu_compiled_cpopup_optionsform_getstrLastTFPosLYSetLastTFPosget_popup_option_numberprev_target.14prev_target_buffer.15gcc2_compiled.__gnu_compiled_cpointers.3set_environsuggested_filenameSetupFilenameRecallFilenameconfirm_by_pagessend_file_to_filefirst_mail_preparsed.16send_file_to_mailsubject_translate8bitsend_file_to_printersend_file_to_screenmy_temp.27gcc2_compiled.__gnu_compiled_cdir_list_style_tblfile_sort_tblkeypad_mode_tbluser_mode_tblvisited_links_tblSkipEqualswrite_listgcc2_compiled.__gnu_compiled_cLYValidDownloadFiletempfile.4gcc2_compiled.__gnu_compiled_cmessage_has_contentterminate_messagegcc2_compiled.__gnu_compiled_cpretty_htmlformat_bindingprint_bindingLYLoadKeymapsaved_vi_keysdid_vi_keyssaved_emacs_keysdid_emacs_keyssaved_number_keysdid_number_keysbest_reverse_keymapgcc2_compiled.__gnu_compiled_cstyleSheetdefault_stylechange_paragraph_styleLYStartAreaLYHandleFIGHTML_end_elementclear_objectdataHTML_start_elementMakeNewMapValueMakeNewTitleMakeNewImageValueHTML_freeHTML_abortget_stylesgcc2_compiled.__gnu_compiled_cHTFWriter_put_characterHTFWriter_put_stringHTFWriter_writeHTFWriter_freeHTFWriter_abortHTFWritergcc2_compiled.__gnu_compiled_cHTLoadTypesConfigFileGetCommandExitWithErrorProcessMailcapEntryPassesTestBuildCommandcmdlist.14RememberTestResultProcessMailcapFileHTLoadExtensionsConfigFileHTGetLineHTGetWordgcc2_compiled.__gnu_compiled_cHTStyleNormalHTStyleDivCenterHTStyleDivLeftHTStyleDivRightHTStyleBannerHTStyleBlockquoteHTStyleBqHTStyleFootnoteHTStyleListHTStyleList1HTStyleList2HTStyleList3HTStyleList4HTStyleList5HTStyleList6HTStyleMenuHTStyleMenu1HTStyleMenu2HTStyleMenu3HTStyleMenu4HTStyleMenu5HTStyleMenu6HTStyleGlossaryHTStyleGlossary1HTStyleGlossary2HTStyleGlossary3HTStyleGlossary4HTStyleGlossary5HTStyleGlossary6HTStyleGlossaryCompactHTStyleGlossaryCompact1HTStyleGlossaryCompact2HTStyleGlossaryCompact3HTStyleGlossaryCompact4HTStyleGlossaryCompact5HTStyleGlossaryCompact6HTStyleExampleHTStylePreformattedHTStyleListingHTStyleAddressHTStyleNoteHTStyleHeading1HTStyleHeading2HTStyleHeading3HTStyleHeading4HTStyleHeading5HTStyleHeading6HTStyleHeadingCenterHTStyleHeadingLeftHTStyleHeadingRightgcc2_compiled.__gnu_compiled_cmenu_headcannot_statok_file_or_dirmove_filenot_already_existsdir_has_same_ownerremove_taggedmodify_taggedmodify_nameget_filenamemodify_locationpermit_locationcreate_filecreate_directoryremove_singlepermissionsLYValidPermitFiletempfile.36DirectoryOftempfile.49render_itemgcc2_compiled.__gnu_compiled_ctempfile.4gcc2_compiled.__gnu_compiled_cALp_RunTimeAllocationsAddToListFindInListRemoveFromListgcc2_compiled.__gnu_compiled_ctopOfStackcallstackLYCompleteExitgcc2_compiled.__gnu_compiled_cLYRead_JumpfileLYComparegcc2_compiled.__gnu_compiled_ctempfile.2last_titles.3gcc2_compiled.__gnu_compiled_cenvc_sizeremember_allocedadd_environment_valueLYLoadCGIgcc2_compiled.__gnu_compiled_cfinal_perrorexit_with_perrorgcc2_compiled.__gnu_compiled_cDefaultEditBindingBetterEditBindingBashlikeEditBindingMod1BindingMod2BindingMod3Bindinggcc2_compiled.__gnu_compiled_cISO_Latin1HTMLSetRawModeDefaultHTMLSetHaveCJKCharacterSetHTMLSetDisplayCharsetMatchLocaleOLD_charset_namesLYEntityNamesunicode_entities.18gcc2_compiled.__gnu_compiled_cOLstring.14OLstring.17OLstring.20OLstring.23UCPutUtf8ToBuffergcc2_compiled.__gnu_compiled_cfill_DocAddressget_the_listLYLoadIMGmapgcc2_compiled.__gnu_compiled_cdomain_listcookie_listtotal_cookiesMemAllocCopynewCookiefreeCookiehost_matchesport_matchesstore_cookiescan_cookie_sublistLYProcessSetCookiesnumber_of_file_cookiesdomain.22secure.27expires_a.28tok_values.29LYHandleCookiesgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cfree_rowinfoStbl_addCellToRowStbl_reserveCellsInRowStbl_finishCellInRowStbl_reserveCellsInTableStbl_cancelRowSpansStbl_finishRowInTableupdate_sumcols0get_remaining_colspanget_fixup_positionsgcc2_compiled.__gnu_compiled_cdfont_unicount_windows_1250dfont_unitable_windows_1250repl_map_windows_1250dfont_replacedesc_windows_1250dfont_unicount_windows_1251dfont_unitable_windows_1251dfont_replacedesc_windows_1251dfont_unicount_windows_1252dfont_unitable_windows_1252repl_map_windows_1252dfont_replacedesc_windows_1252dfont_unicount_windows_1253dfont_unitable_windows_1253dfont_replacedesc_windows_1253dfont_unicount_windows_1255dfont_unitable_windows_1255dfont_replacedesc_windows_1255dfont_unicount_windows_1256dfont_unitable_windows_1256dfont_replacedesc_windows_1256dfont_unicount_windows_1257dfont_unitable_windows_1257dfont_replacedesc_windows_1257dfont_unicount_cp437dfont_unitable_cp437repl_map_cp437dfont_replacedesc_cp437dfont_unicount_cp737dfont_unitable_cp737repl_map_cp737dfont_replacedesc_cp737dfont_unicount_cp775dfont_unitable_cp775dfont_replacedesc_cp775dfont_unicount_cp850dfont_unitable_cp850repl_map_cp850dfont_replacedesc_cp850dfont_unicount_cp852dfont_unitable_cp852repl_map_cp852dfont_replacedesc_cp852dfont_unicount_cp862dfont_unitable_cp862dfont_replacedesc_cp862dfont_unicount_cp864dfont_unitable_cp864dfont_replacedesc_cp864dfont_unicount_cp866dfont_unitable_cp866dfont_replacedesc_cp866dfont_unicount_cp869dfont_unitable_cp869dfont_replacedesc_cp869dfont_unicountdfont_unitabledfont_replacedescdfont_unicount_dec_mcsdfont_unitable_dec_mcsrepl_map_dec_mcsdfont_replacedesc_dec_mcsdfont_unicount_hp_roman8dfont_unitable_hp_roman8dfont_replacedesc_hp_roman8dfont_unicount_iso_8859_1dfont_unitable_iso_8859_1repl_map_iso_8859_1dfont_replacedesc_iso_8859_1dfont_unicount_iso_8859_2dfont_unitable_iso_8859_2repl_map_iso_8859_2dfont_replacedesc_iso_8859_2dfont_unicount_iso_8859_3dfont_unitable_iso_8859_3dfont_replacedesc_iso_8859_3dfont_unicount_iso_8859_4dfont_unitable_iso_8859_4dfont_replacedesc_iso_8859_4dfont_unicount_iso_8859_5dfont_unitable_iso_8859_5repl_map_iso_8859_5dfont_replacedesc_iso_8859_5dfont_unicount_iso_8859_6dfont_unitable_iso_8859_6dfont_replacedesc_iso_8859_6dfont_unicount_iso_8859_7dfont_unitable_iso_8859_7repl_map_iso_8859_7dfont_replacedesc_iso_8859_7dfont_unicount_iso_8859_8dfont_unitable_iso_8859_8repl_map_iso_8859_8dfont_replacedesc_iso_8859_8dfont_unicount_iso_8859_9dfont_unitable_iso_8859_9repl_map_iso_8859_9dfont_replacedesc_iso_8859_9dfont_unicount_iso_8859_10dfont_unitable_iso_8859_10repl_map_iso_8859_10dfont_replacedesc_iso_8859_10dfont_unicount_iso_8859_15dfont_unitable_iso_8859_15dfont_replacedesc_iso_8859_15dfont_unicount_koi8_rdfont_unitable_koi8_rdfont_replacedesc_koi8_rdfont_unicount_macintoshdfont_unitable_macintoshrepl_map_macintoshdfont_replacedesc_macintoshdfont_unicount_mnemonicrepl_map_mnemonicdfont_replacedesc_mnemonicdfont_unicount_nextdfont_unitable_nextdfont_replacedesc_nextdfont_unicount_mnemonic_ascii_0repl_map_mnemonic_ascii_0dfont_replacedesc_mnemonic_ascii_0dfont_unicount_visciidfont_unitable_visciirepl_map_visciidfont_replacedesc_visciidfont_unicount_cp866udfont_unitable_cp866udfont_replacedesc_cp866udfont_unicount_koi8_udfont_unitable_koi8_udfont_replacedesc_koi8_utranslationsUC_translateinv_translateinverse_translationsdefault_UChndlset_inverse_translinv_norm_translconv_uni_to_pcset_translateUC_valid_UC_charsetUC_con_set_transhashtable_contents_validhashtable_str_contents_validuni_pagediruni_pagedir_strUC_current_unitableUC_current_unitable_strunidefault_contents_validunidefault_str_contents_validunidefault_pagedirunidefault_pagedir_strUC_default_unitableUC_default_unitable_strcon_insert_unipaircon_insert_unipair_strcon_clear_unimapcon_clear_unimap_strcon_set_default_unimapUC_con_set_unimap_strUC_con_set_unimapconv_uni_to_strUCconsole_map_initUC_lastautoGNUC_FindGN_byMIMEnested.48getLYhndl_byCPUCreset_allocated_LYCharSetsremember_allocated_LYCharSetsUC_setup_LYCharSets_replUC_Register_with_LYCharSetsUC_NoUctb_Register_with_LYCharSetsUC_Charset_NoUctb_Setupdfont_unitable_mnemonic_ascii_0dfont_unitable_mnemonicgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cisAcceptablegcc2_compiled.__gnu_compiled_cprotocolspushed_assume_LYhndlpushed_assume_MIMEnameHTAccessInitget_physicalHTLoadDocumentisAcceptable.28gcc2_compiled.__gnu_compiled_cHTLoadHTTPgcc2_compiled.__gnu_compiled_cHTMountRootHTCacheRootHTSuffixesno_suffixunknown_suffixFormatStrFormatNumLYListFmtParsedo_readmeprint_local_dirgcc2_compiled.__gnu_compiled_cHTBTElement_freeHTBTElementAndObject_freegcc2_compiled.__gnu_compiled_cHaveYearsconnectionsuser_entered_passwordlast_username_and_hostserver_typeunsure_typeinterrupted_in_next_data_charmaster_socketvmsname.2next_data_chardata_read_pointerdata_write_pointerdata_bufferclose_connectionhelp_message_bufferinit_help_message_cachehelp_message_cache_addhelp_message_cache_non_emptyhelp_message_cache_contentswrite_cmdresponse_textsend_cmd_1send_cmd_2set_mac_binaryget_ftp_pwdset_unix_dirstylefirstuse.31get_connectionclose_master_socketopen_socketsget_listen_socketnum_socketsport_commandset_years_and_datefree_entryinfo_struct_contentsis_ls_dateflagbase.45parse_eplf_lineparse_ls_lineparse_dls_lineparse_vms_dir_entryparse_ms_windows_dir_entryparse_cms_dir_entryparse_dir_entrycompare_EntryInfo_structsread_directorypassive_portgcc2_compiled.__gnu_compiled_cdump_hostentget_host_detailsgcc2_compiled.__gnu_compiled_cset_chartrans_handlingchange_chartrans_handlinghandle_attribute_namehandle_attribute_valueput_special_unicodesFoundEntityhandle_entityreplace_bufhandle_commenthandle_identifierhandle_doctypehandle_markedhandle_sgmlenthandle_sgmlelehandle_sgmlattelement_valid_withincan_closedo_close_stackedis_on_stackend_elementstart_elementSGML_freeSGML_abortSGML_characterSGML_stringSGML_writeIS_SJIS_STRrepairJIStoEUCis_EUC_JPgcc2_compiled.__gnu_compiled_caddress_attrapplet_attrarea_attrbase_attrbgsound_attrbody_attrbodytext_attrbutton_attrcaption_attrcredit_attrembed_attrfieldset_attrfont_attrform_attrframe_attrframeset_attrglossary_attriframe_attrinput_attrisindex_attrkeygen_attrlabel_attrlegend_attrlink_attrlist_attrmath_attrmeta_attrnextid_attrnote_attrobject_attrolist_attroption_attroverlay_attrparam_attrscript_attrselect_attrstyle_attrtable_attrtextarea_attrulist_attrgcc2_compiled.__gnu_compiled_cgcc2_compiled.__gnu_compiled_cHTPlain_bs_pendingHTPlain_getChartransInfoHTPlain_put_characterHTPlain_writeHTPlain_put_stringreplace_bufHTPlain_freeHTPlain_abortgcc2_compiled.__gnu_compiled_cflush_breaksHTMLGen_flushallow_breakHTMLGen_put_characterHTMLGen_put_stringHTMLGen_writeHTMLGen_start_elementHTMLGen_end_elementHTMLGen_put_entityHTMLGen_freePlainToHTML_freeHTMLGen_abortPlainToHTML_abortHTMLGenerationPlainToHTMLConversiongcc2_compiled.__